• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 4, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001146284 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 4, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_001146284.1, 226371622
Length 3919 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 4, mRNA.
Product transcription factor 7-like 2 isoform 4
Comment

Summary: This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes. Several transcript variants encoding multiple different isoforms have been found for this gene.[provided by RefSeq, Oct 2010].


Transcript Variant: This variant (4) has multiple differences in the coding region, compared to variant 1, one of which results in a translational frameshift. The resulting protein (isoform 4) has a distinct C-terminus and is shorter than isoform 1.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_001139756.1
CDS 508..1875
Misc Feature(1)100..102
Misc Feature(2)508..1215
Misc Feature(3)508..1215
Misc Feature(4)1483..1686
Misc Feature(5)order(1486..1491,1495..1500,1507..1512,1519..1521,
Exon (1)1..696
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (2)697..763
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (3)764..888
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (4)889..990
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (5)991..1123
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (6)1124..1214
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (7)1215..1301
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (8)1302..1427
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (9)1428..1587
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (10)1588..1695
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (11)1696..1744
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (12)1745..1795
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Exon (13)1796..3919
Gene:TCF7L2
Gene Synonym:TCF-4; TCF4
Translation MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS LSPTARTYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPL ITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWQGQP VYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSD VGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRR WHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLN PCLSLPPITGEKKSAFATYKVKAAASAHPLQMEAY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
11+dbSNP:
11+g, tdbSNP:77172590
50+g, tdbSNP:185303710
95+c, tdbSNP:190495490
155+, cdbSNP:113102683
163+c, tdbSNP:113409023
201+, ttdbSNP:74804400
416..417+, gdbSNP:200139921
517+c, tdbSNP:182211983
531+a, gdbSNP:113219338
536+a, gdbSNP:188153157
552+c, tdbSNP:76088094
597+a, gdbSNP:192341583
605+a, gdbSNP:148876270
656+a, cdbSNP:79274995
657+c, tdbSNP:199669957
664+a, gdbSNP:184454375
790+dbSNP:
790+c, tdbSNP:201733753
855+c, tdbSNP:143305771
932+dbSNP:
932+a, gdbSNP:139127477
966+a, gdbSNP:140603697
971+a, cdbSNP:13458
985+a, gdbSNP:143077353
1017+dbSNP:
1017+c, tdbSNP:146872546
1043+a, cdbSNP:3197486
1108+a, gdbSNP:190966900
1171+dbSNP:
1171+c, tdbSNP:187396733
1185+c, tdbSNP:200396486
1234+dbSNP:
1234+a, cdbSNP:148523217
1281+c, tdbSNP:145083306
1295+a, tdbSNP:199917787
1347+dbSNP:
1347+a, gdbSNP:150706998
1356+a, gdbSNP:113767743
1362+a, gdbSNP:142028588
1374+a, gdbSNP:201875922
1452+dbSNP:
1452+a, gdbSNP:140535977
1464+a, cdbSNP:2757884
1470+c, gdbSNP:150691578
1561+a, gdbSNP:111888905
1593+dbSNP:
1593+c, tdbSNP:142903496
1671+c, tdbSNP:149820593
1743+dbSNP:
1743+c, tdbSNP:146352267
1846+dbSNP:
1846+a, gdbSNP:191844653
1851+a, cdbSNP:77961654
1887+c, gdbSNP:201257936
1888+a, c, gdbSNP:77673441
1889+c, gdbSNP:149031135
1891+c, tdbSNP:202133956
1898+a, cdbSNP:142246062
1913+g, tdbSNP:201460379
1916+c, gdbSNP:151216935
1923+a, gdbSNP:138649767
1929+c, tdbSNP:58719567
1945+a, cdbSNP:140337355
1971+c, tdbSNP:185631836
1973+c, tdbSNP:76249005
2014+c, tdbSNP:201155099
2087+c, tdbSNP:150354863
2090+g, tdbSNP:191419844
2097+a, cdbSNP:147601829
2102+c, tdbSNP:73362229
2110+c, gdbSNP:147059345
2144+a, gdbSNP:113907149
2155+c, gdbSNP:138340674
2156+c, tdbSNP:199967681
2157+c, tdbSNP:147841431
2188+c, tdbSNP:149556542
2192+c, tdbSNP:143411121
2204+c, tdbSNP:200948170
2208+a, gdbSNP:188333249
2217+c, tdbSNP:200117101
2223+c, tdbSNP:202158086
2232..2233+, adbSNP:141448155
2232+a, cdbSNP:201172396
2240+c, tdbSNP:1056877
2277+c, tdbSNP:114631541
2502+a, cdbSNP:71483172
2672+c, tdbSNP:140330059
2692..2693+, tdbSNP:5787989
2693..2694+, tdbSNP:11378467
2693..2694+, t, ttdbSNP:33993342
2707..2708+, t, ttdbSNP:10665742
2708..2709+, t, ttdbSNP:33930605
2708+a, gdbSNP:200049258
2793+g, tdbSNP:192217246
2815+c, gdbSNP:7099964
2843+c, tdbSNP:184002338
2855+c, gdbSNP:3793883
2898+a, gdbSNP:186775783
2927+a, gdbSNP:191579091
2937+c, tdbSNP:56386996
3021+a, gdbSNP:3167853
3073+c, tdbSNP:78052345
3074+c, tdbSNP:143046274
3107+c, tdbSNP:55699322
3122..3123+, gdbSNP:35361397
3129+, tdbSNP:34227984
3201+a, gdbSNP:182519552
3234+a, gdbSNP:200066265
3272+c, tdbSNP:11196251
3273+a, gdbSNP:150438785
3284+c, tdbSNP:187178316
3287+c, gdbSNP:138209264
3315+c, gdbSNP:731788
3419+a, gdbSNP:192852951
3433..3434+, adbSNP:149548874
3509+c, tdbSNP:137902798
3510+a, gdbSNP:185357908
3549+c, tdbSNP:190131632
3689+a, gdbSNP:149574944
3697+c, tdbSNP:149044108
3730+c, tdbSNP:143071937
3763+a, gdbSNP:184873075
3780+a, tdbSNP:79963628
3804+c, tdbSNP:3635
3914+a, gdbSNP:3208480
Gene SymbolTCF7L2
Gene SynonymTCF-4; TCF4
Chromosome10
Locus Map10q25.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001146274 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 1, mRNA. On-demand $849.00 20
NM_001146283 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 3, mRNA. On-demand $699.00 18
NM_001146284 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 4, mRNA. On-demand $699.00 18
NM_001146285 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 5, mRNA. On-demand $849.00 20
NM_001146286 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 6, mRNA. On-demand $699.00 18
NM_001198525 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 7, mRNA. On-demand $699.00 18
NM_001198526 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 8, mRNA. On-demand $849.00 20
NM_001198527 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 9, mRNA. On-demand $699.00 18
NM_001198528 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 10, mRNA. On-demand $699.00 18
NM_001198529 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 11, mRNA. On-demand $699.00 18
NM_001198530 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 12, mRNA. On-demand $549.00 14
NM_001198531 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 13, mRNA. On-demand $699.00 18
NM_030756 Homo sapiens transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 2, mRNA. On-demand $849.00 20
Title Transferability and fine mapping of type 2 diabetes loci in African Americans: the Candidate Gene Association Resource Plus Study .
Author Ng,M.C., Saxena,R., Li,J., Palmer,N.D., Dimitrov,L., Xu,J., Rasmussen-Torvik,L.J., Zmuda,J.M., Siscovick,D.S., Patel,S.R., Crook,E.D., Sims,M., Chen,Y.D., Bertoni,A.G., Li,M., Grant,S.F., Dupuis,J., Meigs,J.B., Psaty,B.M., Pankow,J.S., Langefeld,C.D., Freedman,B.I., Rotter,J.I., Wilson,J.G. and Bowden,D.W.
Journal Diabetes 62 (3), 965-976 (2013)
Title Transcription factor-7-like 2 gene variants are strongly associated with type 2 diabetes in Tunisian Arab subjects .
Author Turki,A., Al-Zaben,G.S., Mtiraoui,N., Marmmuoch,H., Mahjoub,T. and Almawi,W.Y.
Journal Gene 513 (2), 244-248 (2013)
Title Meta-analysis of associations between TCF7L2 polymorphisms and risk of type 2 diabetes mellitus in the Chinese population .
Author Wang,J., Hu,F., Feng,T., Zhao,J., Yin,L., Li,L., Wang,Y., Wang,Q. and Hu,D.
Journal BMC Med. Genet. 14, 8 (2013)
Title Evaluation of genome-wide association study-identified type 2 diabetes loci in African Americans .
Author Long,J., Edwards,T., Signorello,L.B., Cai,Q., Zheng,W., Shu,X.O. and Blot,W.J.
Journal Am. J. Epidemiol. 176 (11), 995-1001 (2012)
Title Adipose tissue TCF7L2 splicing is regulated by weight loss and associates with glucose and fatty acid metabolism .
Author Kaminska,D., Kuulasmaa,T., Venesmaa,S., Kakela,P., Vaittinen,M., Pulkkinen,L., Paakkonen,M., Gylling,H., Laakso,M. and Pihlajamaki,J.
Journal Diabetes 61 (11), 2807-2813 (2012)
Title Restricted high level expression of Tcf-4 protein in intestinal and mammary gland epithelium .
Author Barker,N., Huls,G., Korinek,V. and Clevers,H.
Journal Am. J. Pathol. 154 (1), 29-35 (1999)
Title Identification of c-MYC as a target of the APC pathway .
Author He,T.C., Sparks,A.B., Rago,C., Hermeking,H., Zawel,L., da Costa,L.T., Morin,P.J., Vogelstein,B. and Kinzler,K.W.
Journal Science 281 (5382), 1509-1512 (1998)
Title Activation of beta-catenin-Tcf signaling in colon cancer by mutations in beta-catenin or APC .
Author Morin,P.J., Sparks,A.B., Korinek,V., Barker,N., Clevers,H., Vogelstein,B. and Kinzler,K.W.
Journal Science 275 (5307), 1787-1790 (1997)
Title Constitutive transcriptional activation by a beta-catenin-Tcf complex in APC-/- colon carcinoma .
Author Korinek,V., Barker,N., Morin,P.J., van Wichen,D., de Weger,R., Kinzler,K.W., Vogelstein,B. and Clevers,H.
Journal Science 275 (5307), 1784-1787 (1997)
Title A gene family of HMG-box transcription factors with homology to TCF-1 .
Author Castrop,J., van Norren,K. and Clevers,H.
Journal Nucleic Acids Res. 20 (3), 611 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.