• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 5 homeobox 1B (POU5F1B), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001159542 Homo sapiens POU class 5 homeobox 1B (POU5F1B), mRNA. Full Lenth $463.71
ORF Sequence $313.20


RefSeq Version NM_001159542.1, 227430409
Length 1599 bp
Structure linear
Update Date 21-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens POU class 5 homeobox 1B (POU5F1B), mRNA.
Product putative POU domain, class 5, transcription factor 1B
Comment

Summary: This intronless gene was thought to be a transcribed pseudogene of POU class 5 homeobox 1, however, it has been reported that this gene can encode a functional protein. The encoded protein is nearly the same length as and highly similar to the POU class 5 homeobox 1 transcription factor, has been shown to be a weak transcriptional activator and may play a role in carcinogenesis and eye development. [provided by RefSeq].

RefSeq NP_001153014.1
CDS 256..1335
Exon (1)1..1599
Exon (2)1..1599
Translation MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGI PPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPG AVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFS QKTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLMQARKRKRTSIENR VRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAA GSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
21+a, tdbSNP:3999777
41..43+, atadbSNP:112002137
169+a, cdbSNP:79782285
205+a, gdbSNP:4871789
232+c, gdbSNP:75427380
303+c, tdbSNP:1061391
309+a, gdbSNP:1061393
353+g, tdbSNP:1061394
397+g, tdbSNP:76449652
441+a, tdbSNP:3211306
462+a, cdbSNP:1061395
complement(489)-g, adbSNP:111310797
489+c, tdbSNP:1061396
489+c, tdbSNP:55635747
555+a, tdbSNP:77810828
782+a, gdbSNP:77932649
782+a, gdbSNP:6998061
782+a, gdbSNP:75641460
800+a, cdbSNP:114126788
800+a, cdbSNP:13273814
895+a, gdbSNP:13274084
895+a, gdbSNP:71520669
939+a, gdbSNP:6998254
939+a, gdbSNP:62513968
939+a, gdbSNP:114470577
967+c, gdbSNP:7002225
967+c, gdbSNP:60346131
1122+c, tdbSNP:28409416
1193+c, tdbSNP:16897482
1193+c, tdbSNP:1062632
1406+c, gdbSNP:9297754
1406+c, gdbSNP:79948117
1418+a, gdbSNP:78695295
1459+a, tdbSNP:77258034
1459+a, tdbSNP:9297755
1470+a, gdbSNP:78931371
1572+c, tdbSNP:3179559
1596..1597+, adbSNP:71303488
complement(1599)-t, cdbSNP:74548710
1599+, agaaagdbSNP:71300227
Gene SymbolPOU5F1B
Gene SynonymOCT4-PG1; OTF3C; OTF3P1; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8
Chromosome8
Locus Map8q24.21
All Transcripts NM_001159542
Title POU5F1P1, a putative cancer susceptibility gene, is overexpressed in prostatic carcinoma .
Author Kastler,S., Honold,L., Luedeke,M., Kuefer,R., Moller,P., Hoegel,J., Vogel,W., Maier,C. and Assum,G.
Journal Prostate 70 (6), 666-674 (2010)
Title Variation at 8q24 and 9p24 and risk of epithelial ovarian cancer .
Author White,K.L., Sellers,T.A., Fridley,B.L., Vierkant,R.A., Phelan,C.M., Tsai,Y.Y., Kalli,K.R., Berchuck,A., Iversen,E.S., Hartmann,L.C., Liebow,M., Armasu,S., Fredericksen,Z., Larson,M.C., Duggan,D., Couch,F.J., Schildkraut,J.M., Cunningham,J.M. and Goode,E.L.
Journal Twin Res Hum Genet 13 (1), 43-56 (2010)
Title Common variants at 2q37.3, 8q24.21, 15q21.3 and 16q24.1 influence chronic lymphocytic leukemia risk .
Author Crowther-Swanepoel,D., Broderick,P., Di Bernardo,M.C., Dobbins,S.E., Torres,M., Mansouri,M., Ruiz-Ponte,C., Enjuanes,A., Rosenquist,R., Carracedo,A., Jurlander,J., Campo,E., Juliusson,G., Montserrat,E., Smedby,K.E., Dyer,M.J., Matutes,E., Dearden,C., Sunter,N.J., Hall,A.G., Mainou-Fowler,T., Jackson,G.H., Summerfield,G., Harris,R.J., Pettitt,A.R., Allsup,D.J., Bailey,J.R., Pratt,G., Pepper,C., Fegan,C., Parker,A., Oscier,D., Allan,J.M., Catovsky,D. and Houlston,R.S.
Journal Nat. Genet. 42 (2), 132-136 (2010)
Title Common variants in 8q24 are associated with risk for prostate cancer and tumor aggressiveness in men of European ancestry .
Author Pal,P., Xi,H., Guha,S., Sun,G., Helfand,B.T., Meeks,J.J., Suarez,B.K., Catalona,W.J. and Deka,R.
Journal Prostate 69 (14), 1548-1556 (2009)
Title The POU5F1P1 pseudogene encodes a putative protein similar to POU5F1 isoform 1 .
Author Panagopoulos,I., Moller,E., Collin,A. and Mertens,F.
Journal Oncol. Rep. 20 (5), 1029-1033 (2008)
Title [Identification of the OCT4-pg1 retrogene and NANOG gene expression in the human embryonic eye] .
Author Firsova,N.V., Markintantova,Iu.V., Smirnova,Iu.A., Panova,I.G., Sukhikh,G.T., Zinov'eva,R.D. and Mitashov,V.I.
Journal Izv. Akad. Nauk. Ser. Biol. 2, 134-138 (2008)
Title Genome-wide association study of prostate cancer identifies a second risk locus at 8q24 .
Author Yeager,M., Orr,N., Hayes,R.B., Jacobs,K.B., Kraft,P., Wacholder,S., Minichiello,M.J., Fearnhead,P., Yu,K., Chatterjee,N., Wang,Z., Welch,R., Staats,B.J., Calle,E.E., Feigelson,H.S., Thun,M.J., Rodriguez,C., Albanes,D., Virtamo,J., Weinstein,S., Schumacher,F.R., Giovannucci,E., Willett,W.C., Cancel-Tassin,G., Cussenot,O., Valeri,A., Andriole,G.L., Gelmann,E.P., Tucker,M., Gerhard,D.S., Fraumeni,J.F. Jr., Hoover,R., Hunter,D.J., Chanock,S.J. and Thomas,G.
Journal Nat. Genet. 39 (5), 645-649 (2007)
Title Oct4 pseudogenes are transcribed in cancers .
Author Suo,G., Han,J., Wang,X., Zhang,J., Zhao,Y., Zhao,Y. and Dai,J.
Journal Biochem. Biophys. Res. Commun. 337 (4), 1047-1051 (2005)
Title Emergence of young human genes after a burst of retroposition in primates .
Author Marques,A.C., Dupanloup,I., Vinckenbosch,N., Reymond,A. and Kaessmann,H.
Journal PLoS Biol. 3 (11), E357 (2005)
Title Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues .
Author Takeda,J., Seino,S. and Bell,G.I.
Journal Nucleic Acids Res. 20 (17), 4613-4620 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878