• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens G protein-coupled receptor 144 (GPR144), mRNA.


RefSeq Accession Definition Services Price Order
NM_001161808 Homo sapiens G protein-coupled receptor 144 (GPR144), mRNA. ORF Sequence $838.68
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001161808.1, 240120160
Length 2892 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens G protein-coupled receptor 144 (GPR144), mRNA.
Product probable G-protein coupled receptor 144
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AL137846.24. On or before Jul 8, 2009 this sequence version replaced gi:169178373, gi:169179400, gi:169181284, gi:239749664, gi:239755162, gi:239743935.


##Evidence-Data-START## Transcript exon combination :: AY278562.1 [ECO:0000332] ##Evidence-Data-END##

RefSeq NP_001155280.1
CDS 1..2892
Misc Feature(1)172..>243
Misc Feature(2)172..>243
Misc Feature(3)355..915
Misc Feature(4)order(511..513,760..762,766..768,787..789,796..798)
Misc Feature(5)order(646..648,697..699,811..813)
Misc Feature(6)<1825..1929
Misc Feature(7)1966..>2487
Misc Feature(8)1987..2049
Misc Feature(9)2074..2136
Misc Feature(10)2161..2223
Misc Feature(11)2287..2349
Misc Feature(12)2401..2463
Misc Feature(13)2572..2634
Misc Feature(14)2641..2703
Misc Feature(15)<1..>2892
Exon (1)57..124
Gene:GPR144
Gene Synonym:PGR24
Exon (2)125..337
Gene:GPR144
Gene Synonym:PGR24
Exon (3)338..979
Gene:GPR144
Gene Synonym:PGR24
Exon (4)980..1078
Gene:GPR144
Gene Synonym:PGR24
Exon (5)1079..1164
Gene:GPR144
Gene Synonym:PGR24
Exon (6)1165..1449
Gene:GPR144
Gene Synonym:PGR24
Exon (7)1450..1561
Gene:GPR144
Gene Synonym:PGR24
Exon (8)1562..1685
Gene:GPR144
Gene Synonym:PGR24
Exon (9)1686..1791
Gene:GPR144
Gene Synonym:PGR24
Exon (10)1792..1947
Gene:GPR144
Gene Synonym:PGR24
Exon (11)1948..2051
Gene:GPR144
Gene Synonym:PGR24
Exon (12)2052..2154
Gene:GPR144
Gene Synonym:PGR24
Exon (13)2155..2308
Gene:GPR144
Gene Synonym:PGR24
Exon (14)2309..2442
Gene:GPR144
Gene Synonym:PGR24
Exon (15)2443..2558
Gene:GPR144
Gene Synonym:PGR24
Exon (16)2559..2679
Gene:GPR144
Gene Synonym:PGR24
Exon (17)2680..2721
Gene:GPR144
Gene Synonym:PGR24
Exon (18)2722..2790
Gene:GPR144
Gene Synonym:PGR24
Exon (19)2791..2892
Gene:GPR144
Gene Synonym:PGR24
Translation MDAPWGAGERWLHGAAVDRSGVSLGPPPTPQVNQGTLGPQVAPVAAGEVVKTAGGVCKFS GQRLSWWQAQESCEQQFGHLALQPPDGVLASRLRDPVWVGQREAPLRRPPQRRARTTAVL VFDERTADRAARLRSPLPELAALTACTHVQWDCASPDPAALFSVAAPALPNALQLRAFAE PGGVVRAALVVRGQHAPFLAAFRADGRWHHVCATWEQRGGRWALFSDGRRRAGARGLGAG HPVPSGGILVLGQDQDSLGGGFSVRHALSGNLTDFHLWARALSPAQLHRARACAPPSEGL LFRWDPGALDVTPSLLPTVWVRLLCPVPSEECPTWNPGPRSEGSELCLEPQPFLCCYRTE PYRRLQDAQSWPGQDVISRVNALANDIVLLPDPLSEVHGALSPAEASSFLGLLEHVLAME MAPLGPAALLAVVRFLKRVVALGAGDPELLLTGPWEQLSQGVVSVASLVLEEQVADTWLS LREVIGGPMALVASVQRLAPLLSTSMTSERPRMRIQHRHAGLSGVTVIHSWFTSRVFQHT LEGPDLEPQAPASSEEANRVQRFLSTQVGSAIISSEVWDVTGEVNVAMTFHLQHRAQSPL FPPHPPSPYTGGAWATTGCSVAALYLDSTACFCNHSTSFAILLQIYEVQRGPEEESLLRT LSFVGCGVSFCALTTTFLLFLVAGVPKSERTTVHKNLTFSLASAEGFLMTSEWAKANEVA CVAVTVAMHFLFLVAFSWMLVEGLLLWRKVVAVSMHPGPGMRLYHATGWGVPVGIVAVTL AMLPHDYVAPGHCWLNVHTNAIWAFVGPVLFVLTANTCILARVVMITVSSARRRARMLSP QPCLQQQIWTQIWATVKPVLVLLPVLGLTWLAGILVHLSPAWAYAAVGLNSIQGLYIFLV YAACNEEVRSALQRMAEKKVAEVLRALGVWGGAAKEHSLPFSVLPLFLPPKPSTPRHPLK APA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
23+dbSNP:
23+a, gdbSNP:76928670
245+dbSNP:
245+a, tdbSNP:185554082
354+dbSNP:
354+a, cdbSNP:114668573
360+a, gdbSNP:144326848
368+a, gdbSNP:7861556
378+c, gdbSNP:7861854
454+c, gdbSNP:184300525
472+c, tdbSNP:11999178
563+c, tdbSNP:139739372
796+c, gdbSNP:72616654
802+c, tdbSNP:67997410
822+c, tdbSNP:78331506
853+g, tdbSNP:149830619
926..927+, gdbSNP:34667194
946+c, tdbSNP:111489760
970+a, cdbSNP:145789254
1031+dbSNP:
1031+a, cdbSNP:75473174
1135+dbSNP:
1135+c, tdbSNP:141098727
1155+c, tdbSNP:117456728
1318+dbSNP:
1318+a, gdbSNP:114623089
1323+a, cdbSNP:186187750
1327+a, gdbSNP:77622235
1358+g, tdbSNP:190957381
1535+dbSNP:
1535+a, gdbSNP:115274677
1541+a, gdbSNP:139356257
1553+a, gdbSNP:192621609
1562+dbSNP:
1562+c, gdbSNP:58155983
1617+c, tdbSNP:148254178
1685+a, gdbSNP:115085739
1697+dbSNP:
1697+c, tdbSNP:188778149
1729+c, gdbSNP:78597609
1743+c, tdbSNP:12347840
1744+a, gdbSNP:192153424
1822+dbSNP:
1822+a, cdbSNP:201238049
1829+a, cdbSNP:202144883
1851+a, gdbSNP:4838184
1888+a, gdbSNP:10986353
1952+dbSNP:
1952+a, gdbSNP:182122146
2001+c, tdbSNP:186767747
2002+a, gdbSNP:148891250
2069+dbSNP:
2069+a, gdbSNP:115664772
2170+dbSNP:
2170+a, gdbSNP:76895556
2179+a, gdbSNP:193166069
2184+a, gdbSNP:113085796
2221+a, gdbSNP:7854446
2239+c, tdbSNP:201255740
2248+a, gdbSNP:10760365
2311+dbSNP:
2311+a, gdbSNP:116872152
2325+c, tdbSNP:149629740
2362+a, gdbSNP:28479896
2387+a, gdbSNP:7030262
2403+c, tdbSNP:202133267
2419+a, gdbSNP:28502496
2422+c, tdbSNP:191874882
2434+a, gdbSNP:201275572
2495+dbSNP:
2495+a, gdbSNP:114565703
2497+c, tdbSNP:76434769
2506+c, gdbSNP:1570580
2527+g, tdbSNP:183725843
2562+dbSNP:
2562+c, tdbSNP:181925501
2641+a, gdbSNP:151185470
2659+a, gdbSNP:10120236
2796+dbSNP:
2796+c, tdbSNP:114553847
2823+a, cdbSNP:150427689
2861+c, gdbSNP:199611182
Gene SymbolGPR144
Gene SynonymPGR24
Chromosome9
Locus Map9q33.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001161808 Homo sapiens G protein-coupled receptor 144 (GPR144), mRNA. Full Length $838.68
ORF Sequence $838.68
Title The human and mouse repertoire of the adhesion family of G-protein-coupled receptors .
Author Bjarnadottir,T.K., Fredriksson,R., Hoglund,P.J., Gloriam,D.E., Lagerstrom,M.C. and Schioth,H.B.
Journal Genomics 84 (1), 23-33 (2004)
Title DNA sequence and analysis of human chromosome 9 .
Author Humphray,S.J., Oliver,K., Hunt,A.R., Plumb,R.W., Loveland,J.E., Howe,K.L., Andrews,T.D., Searle,S., Hunt,S.E., Scott,C.E., Jones,M.C., Ainscough,R., Almeida,J.P., Ambrose,K.D., Ashwell,R.I., Babbage,A.K., Babbage,S., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J., Barlow,K.F., Bates,K., Beasley,H., Beasley,O., Bird,C.P., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burford,D., Burrill,W., Burton,J., Carder,C., Carter,N.P., Chapman,J.C., Chen,Y., Clarke,G., Clark,S.Y., Clee,C.M., Clegg,S., Collier,R.E., Corby,N., Crosier,M., Cummings,A.T., Davies,J., Dhami,P., Dunn,M., Dutta,I., Dyer,L.W., Earthrowl,M.E., Faulkner,L., Fleming,C.J., Frankish,A., Frankland,J.A., French,L., Fricker,D.G., Garner,P., Garnett,J., Ghori,J., Gilbert,J.G., Glison,C., Grafham,D.V., Gribble,S., Griffiths,C., Griffiths-Jones,S., Grocock,R., Guy,J., Hall,R.E., Hammond,S., Harley,J.L., Harrison,E.S., Hart,E.A., Heath,P.D., Henderson,C.D., Hopkins,B.L., Howard,P.J., Howden,P.J., Huckle,E., Johnson,C., Johnson,D., Joy,A.A., Kay,M., Keenan,S., Kershaw,J.K., Kimberley,A.M., King,A., Knights,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A., Leversha,M., Lloyd,C., Lloyd,D.M., Lovell,J., Martin,S., Mashreghi-Mohammadi,M., Matthews,L., McLaren,S., McLay,K.E., McMurray,A., Milne,S., Nickerson,T., Nisbett,J., Nordsiek,G., Pearce,A.V., Peck,A.I., Porter,K.M., Pandian,R., Pelan,S., Phillimore,B., Povey,S., Ramsey,Y., Rand,V., Scharfe,M., Sehra,H.K., Shownkeen,R., Sims,S.K., Skuce,C.D., Smith,M., Steward,C.A., Swarbreck,D., Sycamore,N., Tester,J., Thorpe,A., Tracey,A., Tromans,A., Thomas,D.W., Wall,M., Wallis,J.M., West,A.P., Whitehead,S.L., Willey,D.L., Williams,S.A., Wilming,L., Wray,P.W., Young,L., Ashurst,J.L., Coulson,A., Blocker,H., Durbin,R., Sulston,J.E., Hubbard,T., Jackson,M.J., Bentley,D.R., Beck,S., Rogers,J. and Dunham,I.
Journal Nature 429 (6990), 369-374 (2004)
Title The G protein-coupled receptor repertoires of human and mouse .
Author Vassilatis,D.K., Hohmann,J.G., Zeng,H., Li,F., Ranchalis,J.E., Mortrud,M.T., Brown,A., Rodriguez,S.S., Weller,J.R., Wright,A.C., Bergmann,J.E. and Gaitanaris,G.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 100 (8), 4903-4908 (2003)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878