• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001164410 Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_001164410.1, 256542305
Length 1111 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 2, mRNA.
Product cyclin-dependent kinase 5 isoform 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB487008.1, AC010973.7, BP309068.1, CB114175.1, DQ411039.1 and BC005115.1.


Transcript Variant: This variant (2), also known as CDK5-SV, omits an in-frame coding exon compared to variant 1 resulting in a shorter predicted protein (isoform 2). Expression of this transcript was described by Li et al. (2009; PubMed ID 19693690).

RefSeq NP_001157882.1
CDS 118..900
Misc Feature(1)79..81
Misc Feature(2)118..885
Misc Feature(3)118..885
Misc Feature(4)124..879
Misc Feature(5)order(145..159,169..171,208..210,214..216,307..309,
Misc Feature(6)order(145..159,169..171,208..210,214..216,307..309,
Misc Feature(7)order(157..159,373..375,379..381,460..462,508..519)
Misc Feature(8)order(448..468,508..519)
Exon (1)1..154
Gene:CDK5
Gene Synonym:PSSALRE
Exon (2)155..243
Gene:CDK5
Gene Synonym:PSSALRE
Exon (3)244..311
Gene:CDK5
Gene Synonym:PSSALRE
Exon (4)312..372
Gene:CDK5
Gene Synonym:PSSALRE
Exon (5)373..429
Gene:CDK5
Gene Synonym:PSSALRE
Exon (6)430..504
Gene:CDK5
Gene Synonym:PSSALRE
Exon (7)505..601
Gene:CDK5
Gene Synonym:PSSALRE
Exon (8)602..671
Gene:CDK5
Gene Synonym:PSSALRE
Exon (9)672..732
Gene:CDK5
Gene Synonym:PSSALRE
Exon (10)733..813
Gene:CDK5
Gene Synonym:PSSALRE
Exon (11)814..1094
Gene:CDK5
Gene Synonym:PSSALRE
Translation MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKNGELKLADFGLARAFG IPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQL KRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPV QRISAEEALQHPYFSDFCPP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(66)-dbSNP:
complement(66)-c, adbSNP:368436761
complement(107)-g, cdbSNP:375106537
complement(108)-t, cdbSNP:370700495
complement(187..188)-dbSNP:
complement(187..188)-, cdbSNP:35475821
complement(202)-t, cdbSNP:200087231
complement(265)-dbSNP:
complement(265)-g, adbSNP:377383594
complement(363)-dbSNP:
complement(363)-g, adbSNP:369446117
complement(422)-dbSNP:
complement(422)-g, adbSNP:368886325
complement(427)-t, cdbSNP:200729612
471+dbSNP:
471+c, tdbSNP:1057766
complement(564)-dbSNP:
complement(564)-t, cdbSNP:368677466
complement(633)-dbSNP:
complement(633)-g, adbSNP:376139702
complement(636)-g, adbSNP:375689583
complement(683)-dbSNP:
complement(683)-g, adbSNP:369223059
complement(690)-g, adbSNP:369291948
complement(696)-c, adbSNP:35186917
complement(704)-g, adbSNP:374928837
complement(741)-dbSNP:
complement(741)-c, adbSNP:62490285
complement(800)-t, cdbSNP:113702561
complement(855)-dbSNP:
complement(855)-t, adbSNP:202114425
complement(863)-g, adbSNP:200333664
complement(864)-t, gdbSNP:386518817
864+g, tdbSNP:11541602
905+c, tdbSNP:2069460
complement(906)-t, cdbSNP:371735422
complement(914)-t, gdbSNP:368178302
915+a, gdbSNP:79627316
986+c, tdbSNP:35051446
complement(1015)-t, cdbSNP:2069461
1016+a, gdbSNP:9278
complement(1018)-t, cdbSNP:116863165
complement(1035)-g, adbSNP:144982250
Gene SymbolCDK5
Gene SynonymPSSALRE
Chromosome7
Locus Map7q36
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004935 Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 1, mRNA. In-stock $348.00 $299.00 10
NM_001164410 Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 2, mRNA. On-demand $449.00 14
Title Cyclin-dependent kinase 5 (Cdk5) regulates the function of CLOCK protein by direct phosphorylation .
Author Kwak Y, Jeong J, Lee S, Park YU, Lee SA, Han DH, Kim JH, Ohshima T, Mikoshiba K, Suh YH, Cho S and Park SK.
Journal J. Biol. Chem. 288 (52), 36878-36889 (2013)
Title Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators .
Author Saito T, Yano M, Kawai Y, Asada A, Wada M, Doi H and Hisanaga S.
Journal J. Biol. Chem. 288 (45), 32433-32439 (2013)
Title Cyclin-dependent kinase 5 modulates STAT3 and androgen receptor activation through phosphorylation of Ser(7)(2)(7) on STAT3 in prostate cancer cells .
Author Hsu FN, Chen MC, Lin KC, Peng YT, Li PC, Lin E, Chiang MC, Hsieh JT and Lin H.
Journal Am. J. Physiol. Endocrinol. Metab. 305 (8), E975-E986 (2013)
Title The role of Cdk5 in neuroendocrine thyroid cancer .
Author Pozo K, Castro-Rivera E, Tan C, Plattner F, Schwach G, Siegl V, Meyer D, Guo A, Gundara J, Mettlach G, Richer E, Guevara JA, Ning L, Gupta A, Hao G, Tsai LH, Sun X, Antich P, Sidhu S, Robinson BG, Chen H, Nwariaku FE, Pfragner R, Richardson JA and Bibb JA.
Journal Cancer Cell 24 (4), 499-511 (2013)
Title EGFR/MEK/ERK/CDK5-dependent integrin-independent FAK phosphorylated on serine 732 contributes to microtubule depolymerization and mitosis in tumor cells .
Author Rea K, Sensi M, Anichini A, Canevari S and Tomassetti A.
Journal Cell Death Dis 4, E815 (2013)
Title Hyperphosphorylation of tau in PHF .
Author Morishima-Kawashima M, Hasegawa M, Takio K, Suzuki M, Yoshida H, Watanabe A, Titani K and Ihara Y.
Journal Neurobiol. Aging 16 (3), 365-371 (1995)
Title Expression of CDK5 (PSSALRE kinase), a neural cdc2-related protein kinase, in the mature and developing mouse central and peripheral nervous systems .
Author Ino H, Ishizuka T, Chiba T and Tatibana M.
Journal Brain Res. 661 (1-2), 196-206 (1994)
Title p42 MAP kinase phosphorylation sites in microtubule-associated protein tau are dephosphorylated by protein phosphatase 2A1. Implications for Alzheimer's disease [corrected] .
Author Goedert M, Cohen ES, Jakes R and Cohen P.
Journal FEBS Lett. 312 (1), 95-99 (1992)
Title A family of human cdc2-related protein kinases .
Author Meyerson M, Enders GH, Wu CL, Su LK, Gorka C, Nelson C, Harlow E and Tsai LH.
Journal EMBO J. 11 (8), 2909-2917 (1992)
Title Proceedings: Aneurysmal bone cysts of the spine .
Author Ameli,N.O., Teymoorian,G.A., Saleh,H. and Slamdoost,A.
Journal Acta Neurochir (Wien) 31 (3-4), 273 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.