• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_001164410 Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 2, mRNA. ORF Sequence $227.07
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001164410.1, 256542305
Length 1111 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 2, mRNA.
Product cyclin-dependent kinase 5 isoform 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB487008.1, AC010973.6, BP309068.1, CB114175.1, DQ411039.1 and BC005115.1.


Transcript Variant: This variant (2), also known as CDK5-SV, omits an in-frame coding exon compared to variant 1 resulting in a shorter predicted protein (isoform 2). Expression of this transcript was described by Li et al. (2009; PubMed ID 19693690).

RefSeq NP_001157882.1
CDS 118..900
Misc Feature(1)79..81
Misc Feature(2)79..81
Misc Feature(3)118..885
Misc Feature(4)118..885
Misc Feature(5)124..879
Misc Feature(6)order(145..159,169..171,208..210,214..216,307..309,
Misc Feature(7)order(145..159,169..171,208..210,214..216,307..309,
Misc Feature(8)order(157..159,373..375,379..381,460..462,508..519)
Misc Feature(9)order(448..468,508..519)
Exon (1)1..154
Gene:CDK5
Gene Synonym:PSSALRE
Exon (2)155..243
Gene:CDK5
Gene Synonym:PSSALRE
Exon (3)244..311
Gene:CDK5
Gene Synonym:PSSALRE
Exon (4)312..372
Gene:CDK5
Gene Synonym:PSSALRE
Exon (5)373..429
Gene:CDK5
Gene Synonym:PSSALRE
Exon (6)430..504
Gene:CDK5
Gene Synonym:PSSALRE
Exon (7)505..601
Gene:CDK5
Gene Synonym:PSSALRE
Exon (8)602..671
Gene:CDK5
Gene Synonym:PSSALRE
Exon (9)672..732
Gene:CDK5
Gene Synonym:PSSALRE
Exon (10)733..813
Gene:CDK5
Gene Synonym:PSSALRE
Exon (11)814..1094
Gene:CDK5
Gene Synonym:PSSALRE
Translation MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKNGELKLADFGLARAFG IPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQL KRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPV QRISAEEALQHPYFSDFCPP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(189..190)-dbSNP:
complement(189..190)-, cdbSNP:35475821
complement(202)-t, cdbSNP:200087231
complement(427)-dbSNP:
complement(427)-t, cdbSNP:200729612
complement(471)-dbSNP:
complement(471)-t, cdbSNP:1057766
complement(696)-dbSNP:
complement(696)-c, adbSNP:35186917
complement(741)-dbSNP:
complement(741)-c, adbSNP:62490285
complement(800)-t, cdbSNP:113702561
complement(855)-dbSNP:
complement(855)-t, adbSNP:202114425
complement(863)-g, adbSNP:200333664
complement(864)-t, gdbSNP:11541602
complement(905)-t, cdbSNP:2069460
complement(915)-g, adbSNP:79627316
complement(986)-t, cdbSNP:35051446
complement(1015)-t, cdbSNP:2069461
complement(1016)-g, adbSNP:9278
complement(1018)-t, cdbSNP:116863165
complement(1035)-g, adbSNP:144982250
Gene SymbolCDK5
Gene SynonymPSSALRE
Chromosome7
Locus Map7q36
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001164410 Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 2, mRNA. Full Length $322.19
ORF Sequence $227.07
NM_004935 Homo sapiens cyclin-dependent kinase 5 (CDK5), transcript variant 1, mRNA. Full Length $351.19
ORF Sequence $254.91
Title Phosphoregulation of the RNA-binding protein Hu antigen R (HuR) by Cdk5 affects centrosome function .
Author Filippova,N., Yang,X., King,P. and Nabors,L.B.
Journal J. Biol. Chem. 287 (38), 32277-32287 (2012)
Title Phosphorylation of gephyrin in hippocampal neurons by cyclin-dependent kinase CDK5 at Ser-270 is dependent on collybistin .
Author Kuhse,J., Kalbouneh,H., Schlicksupp,A., Mukusch,S., Nawrotzki,R. and Kirsch,J.
Journal J. Biol. Chem. 287 (37), 30952-30966 (2012)
Title S-nitrosylation of Cdk5: potential implications in amyloid-beta-related neurotoxicity in Alzheimer disease .
Author Qu,J., Nakamura,T., Holland,E.A., McKercher,S.R. and Lipton,S.A.
Journal Prion 6 (4), 364-370 (2012)
Title Interplay between MEK-ERK signaling, cyclin D1, and cyclin-dependent kinase 5 regulates cell cycle reentry and apoptosis of neurons .
Author Modi,P.K., Komaravelli,N., Singh,N. and Sharma,P.
Journal Mol. Biol. Cell 23 (18), 3722-3730 (2012)
Title Cyclin-dependent kinase 5-mediated hyperphosphorylation of sirtuin-1 contributes to the development of endothelial senescence and atherosclerosis .
Author Bai,B., Liang,Y., Xu,C., Lee,M.Y., Xu,A., Wu,D., Vanhoutte,P.M. and Wang,Y.
Journal Circulation 126 (6), 729-740 (2012)
Title Hyperphosphorylation of tau in PHF .
Author Morishima-Kawashima,M., Hasegawa,M., Takio,K., Suzuki,M., Yoshida,H., Watanabe,A., Titani,K. and Ihara,Y.
Journal Neurobiol. Aging 16 (3), 365-371 (1995)
Title Expression of CDK5 (PSSALRE kinase), a neural cdc2-related protein kinase, in the mature and developing mouse central and peripheral nervous systems .
Author Ino,H., Ishizuka,T., Chiba,T. and Tatibana,M.
Journal Brain Res. 661 (1-2), 196-206 (1994)
Title p42 MAP kinase phosphorylation sites in microtubule-associated protein tau are dephosphorylated by protein phosphatase 2A1. Implications for Alzheimer's disease [corrected] .
Author Goedert,M., Cohen,E.S., Jakes,R. and Cohen,P.
Journal FEBS Lett. 312 (1), 95-99 (1992)
Title A family of human cdc2-related protein kinases .
Author Meyerson,M., Enders,G.H., Wu,C.L., Su,L.K., Gorka,C., Nelson,C., Harlow,E. and Tsai,L.H.
Journal EMBO J. 11 (8), 2909-2917 (1992)
Title Proceedings: Aneurysmal bone cysts of the spine .
Author Ameli,N.O., Teymoorian,G.A., Saleh,H. and Slamdoost,A.
Journal Acta Neurochir (Wien) 31 (3-4), 273 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878