• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens apolipoprotein A-V (APOA5), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001166598 Homo sapiens apolipoprotein A-V (APOA5), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_001166598.1, 262231736
Length 1930 bp
Structure linear
Update Date 13-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens apolipoprotein A-V (APOA5), transcript variant 2, mRNA.
Product apolipoprotein A-V precursor
Comment

Summary: The protein encoded by this gene is an apolipoprotein that plays an important role in regulating the plasma triglyceride levels, a major risk factor for coronary artery disease. It is a component of high density lipoprotein and is highly similar to a rat protein that is upregulated in response to liver injury. Mutations in this gene have been associated with hypertriglyceridemia and hyperlipoproteinemia type 5. This gene is located proximal to the apolipoprotein gene cluster on chromosome 11q23. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Oct 2009].


Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Both variants 1 and 2 encode the same protein.

RefSeq NP_001160070.1
CDS 50..1150
Misc Feature(1)35..37
Misc Feature(2)281..820
Exon (1)1..41
Gene:APOA5
Gene Synonym:APOAV; RAP3
Exon (2)42..98
Gene:APOA5
Gene Synonym:APOAV; RAP3
Exon (3)99..210
Gene:APOA5
Gene Synonym:APOAV; RAP3
Exon (4)211..1908
Gene:APOA5
Gene Synonym:APOAV; RAP3
Translation MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSL EQDLNNMNKFLEKLRPLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGW NLEGLRQQLKPYTMDLMEQVALRVQELQEQLRVVGEDTKAQLLGGVDEAWALLQGLQSRV VHHTGRFKELFHPYAESLVSGIGRHVQELHRSVAPHAPASPARLSRCVQVLSRKLTLKAK ALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFT RAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGH SHLGDP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(9)-dbSNP:
complement(9)-t, cdbSNP:45611741
complement(22)-g, adbSNP:186726407
complement(47)-dbSNP:
complement(47)-t, cdbSNP:651821
complement(67)-g, adbSNP:199724136
complement(105)-dbSNP:
complement(105)-g, cdbSNP:3135506
complement(119)-t, gdbSNP:144178633
complement(134)-t, cdbSNP:139630081
complement(153)-t, cdbSNP:184390502
complement(155)-g, cdbSNP:146323308
complement(160)-t, gdbSNP:34282181
complement(168)-c, adbSNP:148778842
complement(181)-t, gdbSNP:12287066
complement(202)-t, gdbSNP:149652056
complement(214)-dbSNP:
complement(214)-g, cdbSNP:138300114
complement(217)-t, g, cdbSNP:147142271
complement(248)-t, cdbSNP:372084940
complement(329)-g, adbSNP:201686049
complement(338)-g, adbSNP:201079485
complement(343)-g, cdbSNP:143382500
complement(344)-t, cdbSNP:138033117
complement(345)-t, cdbSNP:201115317
complement(362)-c, adbSNP:146964666
complement(380)-t, cdbSNP:371403919
complement(425)-t, gdbSNP:140178861
complement(434)-t, gdbSNP:199974844
464+c, tdbSNP:121917821
complement(483)-t, cdbSNP:368739905
complement(506)-t, cdbSNP:3135507
complement(553)-g, cdbSNP:370837638
complement(568)-t, cdbSNP:149112933
588+a, gdbSNP:34543602
complement(600)-g, cdbSNP:201229911
602+g, tdbSNP:2075291
complement(603)-t, cdbSNP:144211639
complement(646)-t, cdbSNP:374702553
complement(655)-g, adbSNP:140482460
complement(685)-g, adbSNP:371545524
complement(686)-t, cdbSNP:376891081
complement(693)-g, adbSNP:76753536
complement(697)-g, adbSNP:370906477
complement(698..699)-, gdbSNP:71469115
complement(745)-t, g, cdbSNP:146781249
complement(757)-g, cdbSNP:374068229
complement(782)-g, adbSNP:376196775
complement(800)-t, cdbSNP:372966851
complement(872)-g, adbSNP:149808404
complement(873..874)-, tdbSNP:34767938
complement(879)-g, adbSNP:375950328
complement(886)-c, adbSNP:150667142
complement(890)-t, cdbSNP:142901239
complement(897)-t, cdbSNP:140206085
complement(924)-g, adbSNP:34832733
complement(931)-t, cdbSNP:113986025
complement(935)-t, cdbSNP:199689773
complement(943)-g, adbSNP:372918863
complement(951)-t, cdbSNP:370089477
complement(986)-g, adbSNP:147528707
complement(993)-g, adbSNP:143292359
complement(994)-t, cdbSNP:200738033
complement(1011)-t, adbSNP:201201147
complement(1024)-g, adbSNP:137942813
complement(1049)-t, cdbSNP:61743807
complement(1050)-c, adbSNP:147349873
complement(1072)-g, cdbSNP:7120555
complement(1085)-t, cdbSNP:369952307
complement(1159)-t, gdbSNP:375881609
complement(1162)-g, adbSNP:185060854
complement(1175)-g, adbSNP:369734876
complement(1181)-t, cdbSNP:619054
complement(1197)-c, adbSNP:369740771
complement(1200)-c, adbSNP:376976905
complement(1209)-t, gdbSNP:192708363
1226+c, tdbSNP:34089864
complement(1273)-g, cdbSNP:112650726
complement(1295)-t, cdbSNP:45459507
1308+c, tdbSNP:2266788
complement(1322)-g, adbSNP:114627122
complement(1341)-g, adbSNP:188133936
complement(1434..1435)-, tcdbSNP:397897431
complement(1435..1436)-, tcdbSNP:72525532
complement(1438..1439)-, ct, tcdbSNP:45596738
complement(1439..1440)-, ctdbSNP:148759216
complement(1455)-t, cdbSNP:76463524
1544+c, tdbSNP:33984246
complement(1708)-t, cdbSNP:182378073
1792+a, tdbSNP:35009896
1841+a, gdbSNP:35822632
complement(1863)-g, cdbSNP:146109377
Gene SymbolAPOA5
Gene SynonymAPOAV; RAP3
Chromosome11
Locus Map11q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001166598 Homo sapiens apolipoprotein A-V (APOA5), transcript variant 2, mRNA. On-demand $549.00 14
NM_052968 Homo sapiens apolipoprotein A-V (APOA5), transcript variant 1, mRNA. On-demand $549.00 14
XM_006718761 PREDICTED: Homo sapiens apolipoprotein A-V (APOA5), transcript variant X1, mRNA. On-demand $549.00 14
Title Apolipoprotein A5 T-1131C variant and risk for metabolic syndrome in obese adolescents .
Author Zaki M and Amr K.
Journal Gene 534 (1), 44-47 (2014)
Title An APOA5 3' UTR variant associated with plasma triglycerides triggers APOA5 downregulation by creating a functional miR-485-5p binding site .
Author Caussy C, Charriere S, Marcais C, Di Filippo M, Sassolas A, Delay M, Euthine V, Jalabert A, Lefai E, Rome S and Moulin P.
Journal Am. J. Hum. Genet. 94 (1), 129-134 (2014)
Title Genetic association with lipids in Filipinos: waist circumference modifies an APOA5 effect on triglyceride levels .
Author Wu Y, Marvelle AF, Li J, Croteau-Chonka DC, Feranil AB, Kuzawa CW, Li Y, Adair LS and Mohlke KL.
Journal J. Lipid Res. 54 (11), 3198-3205 (2013)
Title Apolipoprotein A5 gene variants and the risk of coronary heart disease: a casecontrol study and metaanalysis .
Author Zhou J, Xu L, Huang RS, Huang Y, Le Y, Jiang D, Yang X, Xu W, Huang X, Dong C, Ye M, Lian J and Duan S.
Journal Mol Med Rep 8 (4), 1175-1182 (2013)
Title Identification and characterization of cyclic AMP response element-binding protein H response element in the human apolipoprotein A5 gene promoter .
Author Song KH, Park AY, Kim JE and Ma JY.
Journal Biomed Res Int 2013, 892491 (2013)
Title Definitive N-terminal protein sequence and further characterization of the novel apolipoprotein A5 in human serum .
Author Alborn WE, Johnson MG, Prince MJ and Konrad RJ.
Journal Clin. Chem. 52 (3), 514-517 (2006)
Title The genetic effect of the apoprotein AV gene on the serum triglyceride level in Japanese .
Author Nabika T, Nasreen S, Kobayashi S and Masuda J.
Journal Atherosclerosis 165 (2), 201-204 (2002)
Title Two independent apolipoprotein A5 haplotypes influence human plasma triglyceride levels .
Author Pennacchio LA, Olivier M, Hubacek JA, Krauss RM, Rubin EM and Cohen JC.
Journal Hum. Mol. Genet. 11 (24), 3031-3038 (2002)
Title Apolipoprotein A-V: a novel apolipoprotein associated with an early phase of liver regeneration .
Author van der Vliet HN, Sammels MG, Leegwater AC, Levels JH, Reitsma PH, Boers W and Chamuleau RA.
Journal J. Biol. Chem. 276 (48), 44512-44520 (2001)
Title An apolipoprotein influencing triglycerides in humans and mice revealed by comparative sequencing .
Author Pennacchio LA, Olivier M, Hubacek JA, Cohen JC, Cox DR, Fruchart JC, Krauss RM and Rubin EM.
Journal Science 294 (5540), 169-173 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.