• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001171 Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_001171.5, 190343022
Length 5125 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 1, mRNA.
Product multidrug resistance-associated protein 6 isoform 1
Comment

Summary: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and it encodes the longer protein (isoform 1).

RefSeq NP_001162.4
CDS 38..4549
Misc Feature(1)77..4543
Misc Feature(2)77..4543
Misc Feature(3)131..193
Misc Feature(4)254..316
Misc Feature(5)332..394
Misc Feature(6)431..484
Misc Feature(7)539..601
Misc Feature(8)944..1006
Misc Feature(9)968..>1591
Misc Feature(10)1085..1147
Misc Feature(11)1316..1378
Misc Feature(12)1388..1450
Misc Feature(13)1637..1699
Misc Feature(14)1763..1825
Misc Feature(15)1922..2524
Misc Feature(16)2024..2047
Misc Feature(17)order(2033..2038,2042..2050,2129..2131,2366..2371,
Misc Feature(18)2120..2131
Misc Feature(19)2294..2323
Misc Feature(20)2354..2371
Misc Feature(21)2378..2389
Misc Feature(22)2459..2479
Misc Feature(23)2855..2917
Misc Feature(24)2873..3685
Misc Feature(25)3029..3091
Misc Feature(26)3221..3283
Misc Feature(27)3287..3349
Misc Feature(28)3563..3625
Misc Feature(29)3632..3694
Misc Feature(30)3824..4486
Exon (1)1..73
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (2)74..256
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (3)257..382
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (4)383..511
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (5)512..637
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (6)638..699
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (7)700..831
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (8)832..1035
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (9)1036..1213
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (10)1214..1375
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (11)1376..1468
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (12)1469..1672
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (13)1673..1816
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (14)1817..1904
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (15)1905..1980
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (16)1981..2107
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (17)2108..2284
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (18)2285..2452
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (19)2453..2627
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (20)2628..2703
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (21)2704..2824
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (22)2825..3032
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (23)3033..3343
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (24)3344..3543
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (25)3544..3670
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (26)3671..3772
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (27)3773..3919
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (28)3920..4078
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (29)4079..4245
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (30)4246..4440
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (31)4441..5117
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Translation MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGR GYLRMSPLFKAKMVLGFALIVLCTSSVAVALWKIQQGTPEAPEFLIHPTVWLTTMSFAVF LIHTERKKGVQSSGVLFGYWLLCFVLPATNAAQQASGAGFQSDPVRHLSTYLCLSLVVAQ FVLSCLADQPPFFPEDPQQSNPCPETGAAFPSKATFWWVSGLVWRGYRRPLRPKDLWSLG RENSSEELVSRLEKEWMRNRSAARRHNKAIAFKRKGGSGMKAPETEPFLRQEGSQWRPLL KAIWQVFHSTFLLGTLSLIISDVFRFTVPKLLSLFLEFIGDPKPPAWKGYLLAVLMFLSA CLQTLFEQQNMYRLKVLQMRLRSAITGLVYRKVLALSSGSRKASAVGDVVNLVSVDVQRL TESVLYLNGLWLPLVWIVVCFVYLWQLLGPSALTAIAVFLSLLPLNFFISKKRNHHQEEQ MRQKDSRARLTSSILRNSKTIKFHGWEGAFLDRVLGIRGQELGALRTSGLLFSVSLVSFQ VSTFLVALVVFAVHTLVAENAMNAEKAFVTLTVLNILNKAQAFLPFSIHSLVQARVSFDR LVTFLCLEEVDPGVVDSSSSGSAAGKDCITIHSATFAWSQESPPCLHRINLTVPQGCLLA VVGPVGAGKSSLLSALLGELSKVEGFVSIEGAVAYVPQEAWVQNTSVVENVCFGQELDPP WLERVLEACALQPDVDSFPEGIHTSIGEQGMNLSGGQKQRLSLARAVYRKAAVYLLDDPL AALDAHVGQHVFNQVIGPGGLLQGTTRILVTHALHILPQADWIIVLANGAIAEMGSYQEL LQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRT TSEAQTEVPLDDPDRAGWPAGKDSIQYGRVKATVHLAYLRAVGTPLCLYALFLFLCQQVA SFCRGYWLSLWADDPAVGGQQTQAALRGGIFGLLGCLQAIGLFASMAAVLLGGARASRLL FQRLLWDVVRSPISFFERTPIGHLLNRFSKETDTVDVDIPDKLRSLLMYAFGLLEVSLVV AVATPLATVAILPLFLLYAGFQSLYVVSSCQLRRLESASYSSVCSHMAETFQGSTVVRAF RTQAPFVAQNNARVDESQRISFPRLVADRWLAANVELLGNGLVFAAATCAVLSKAHLSAG LVGFSVSAALQVTQTLQWVVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWP QGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAE GGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQL KALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQM QAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQES GLV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(142)-dbSNP:
complement(142)-, adbSNP:72664223
complement(150)-g, cdbSNP:72653752
complement(216)-t, cdbSNP:183648123
complement(219)-g, adbSNP:72657696
complement(257..259)-dbSNP:
complement(257..259)-, gtgdbSNP:72664225
complement(423)-dbSNP:
complement(423)-g, adbSNP:72653753
complement(510)-t, cdbSNP:2606921
complement(524)-dbSNP:
complement(524)-t, cdbSNP:192110266
complement(533)-g, adbSNP:201766106
586+a, gdbSNP:72664281
complement(656)-dbSNP:
complement(656)-g, adbSNP:72657697
682+a, gdbSNP:72664282
complement(691)-t, gdbSNP:72653754
complement(713)-dbSNP:
complement(713)-g, adbSNP:72653755
complement(761)-t, gdbSNP:72650697
complement(771)-t, gdbSNP:151150835
complement(779)-t, cdbSNP:72653756
complement(788)-g, adbSNP:199645691
complement(791)-t, cdbSNP:72653757
complement(830)-g, adbSNP:72657698
complement(851)-dbSNP:
complement(851)-g, adbSNP:199534175
complement(863)-t, cdbSNP:200051606
complement(866)-t, cdbSNP:201615561
complement(878)-t, cdbSNP:4780606
complement(892)-g, adbSNP:4780605
complement(902..926)-, ctacggcaagaagggagccagtggcdbSNP:74315139
complement(905)-g, adbSNP:200330935
complement(927)-t, cdbSNP:199729978
complement(975..976)-, tdbSNP:72664216
complement(992)-g, adbSNP:72657699
complement(997)-, cdbSNP:72664226
complement(1030)-c, adbSNP:146523238
complement(1058)-dbSNP:
complement(1058)-g, cdbSNP:145232796
complement(1080)-t, gdbSNP:139704042
complement(1081)-t, cdbSNP:147267670
complement(1093)-g, adbSNP:200738286
complement(1096)-g, adbSNP:150016641
complement(1101)-t, gdbSNP:72653758
complement(1111)-g, adbSNP:139317080
complement(1114)-g, adbSNP:72664283
complement(1124)-t, cdbSNP:72650698
complement(1125..1157)-, aaacgctgtttgagcagcagaacatgtacaggcdbSNP:74315156
complement(1128)-g, cdbSNP:72653759
complement(1145)-g, adbSNP:72653760
complement(1169)-t, cdbSNP:72650699
complement(1178)-t, cdbSNP:72664284
complement(1181)-t, cdbSNP:72653761
complement(1186)-t, cdbSNP:138992331
complement(1208)-g, adbSNP:72653762
complement(1213)-g, cdbSNP:72653763
complement(1229)-dbSNP:
complement(1229)-g, adbSNP:72653764
complement(1251)-g, adbSNP:115663615
complement(1270)-g, c, adbSNP:9930886
complement(1280)-t, cdbSNP:200582171
complement(1281)-t, cdbSNP:72653765
complement(1282)-t, cdbSNP:9940825
complement(1285)-g, adbSNP:143487365
complement(1300)-g, adbSNP:114179357
complement(1312)-g, cdbSNP:201682224
complement(1320)-t, cdbSNP:201880691
complement(1321)-t, cdbSNP:57499497
complement(1348)-t, gdbSNP:150075392
complement(1355)-t, gdbSNP:72653766
complement(1360)-g, adbSNP:200519199
complement(1365)-t, cdbSNP:142007498
complement(1381)-dbSNP:
complement(1381)-g, adbSNP:58703366
complement(1390)-g, adbSNP:57546826
complement(1400)-g, cdbSNP:67996819
complement(1405)-g, adbSNP:141309818
complement(1425)-t, adbSNP:72653767
complement(1461)-t, adbSNP:151187637
complement(1497)-dbSNP:
complement(1497)-g, adbSNP:72653768
complement(1521)-t, adbSNP:72653769
complement(1528)-c, adbSNP:72653770
complement(1542)-t, adbSNP:72653771
complement(1554)-t, cdbSNP:151130276
complement(1577)-t, cdbSNP:59157279
complement(1589)-t, c, adbSNP:72650700
complement(1590)-g, adbSNP:72653772
complement(1606)-t, gdbSNP:145764775
complement(1607)-t, cdbSNP:143588929
complement(1611..1612)-, gdbSNP:72664217
complement(1622)-t, cdbSNP:140045277
complement(1623)-t, cdbSNP:199643353
complement(1637)-c, adbSNP:199634124
complement(1640)-t, cdbSNP:72653773
complement(1676)-dbSNP:
complement(1676)-g, adbSNP:56877937
complement(1689)-t, cdbSNP:72653774
complement(1712)-t, cdbSNP:114149656
complement(1722)-t, cdbSNP:72653775
complement(1736)-t, cdbSNP:143092672
complement(1740)-g, adbSNP:66864704
complement(1768)-g, adbSNP:139771750
complement(1808)-g, cdbSNP:201193903
complement(1811)-t, cdbSNP:190761354
complement(1818)-dbSNP:
complement(1818)-t, cdbSNP:72653776
complement(1820)-g, adbSNP:150866831
complement(1835)-t, cdbSNP:72653777
complement(1852)-t, cdbSNP:61318127
complement(1878)-g, adbSNP:12931472
complement(1894..1895)-, cdbSNP:72664218
complement(1918)-dbSNP:
complement(1918)-g, adbSNP:143100448
complement(1927)-g, cdbSNP:8058696
complement(1933)-t, gdbSNP:8058694
complement(1981..2002)-dbSNP:
complement(1981..2002)-, aataaacctcacggtgccccagdbSNP:74315158
complement(1992)-g, adbSNP:146936233
complement(1993)-t, cdbSNP:141399693
complement(2001)-g, adbSNP:72653779
complement(2004..2026)-, gctgtctgctggctgttgtcggtdbSNP:74315130
complement(2024)-t, gdbSNP:72653780
complement(2027)-t, cdbSNP:59002125
complement(2031)-g, adbSNP:4341770
complement(2032)-, gdbSNP:72664227
complement(2033)-t, gdbSNP:72653781
complement(2036)-, gdbSNP:72664228
complement(2055)-g, adbSNP:67470842
complement(2067)-t, cdbSNP:72653782
complement(2084)-c, adbSNP:150128722
complement(2095)-t, cdbSNP:57866002
complement(2104)-g, adbSNP:61266641
complement(2111)-dbSNP:
complement(2111)-t, cdbSNP:151272575
complement(2116)-t, cdbSNP:189252048
complement(2118)-g, adbSNP:199951066
complement(2122)-g, adbSNP:199913903
complement(2123)-t, cdbSNP:143731811
complement(2130)-c, adbSNP:72653783
complement(2134)-t, gdbSNP:72653784
complement(2162)-t, cdbSNP:114303883
complement(2168)-t, cdbSNP:200800189
complement(2171)-g, adbSNP:140013237
complement(2176)-g, adbSNP:115546382
complement(2177)-t, cdbSNP:200513114
complement(2199)-g, adbSNP:72650701
complement(2203)-t, cdbSNP:201193229
complement(2208)-g, adbSNP:58073789
complement(2212)-t, adbSNP:59757815
complement(2214)-t, cdbSNP:72653785
complement(2244)-t, cdbSNP:148573422
complement(2261)-g, adbSNP:59593133
complement(2282)-g, adbSNP:66616070
complement(2289)-dbSNP:
complement(2289)-t, adbSNP:72653786
complement(2299)-g, adbSNP:149822534
complement(2300)-g, adbSNP:72653787
complement(2305)-t, gdbSNP:116633099
complement(2315)-t, cdbSNP:72653788
complement(2331)-g, adbSNP:67561842
complement(2334)-c, adbSNP:72653789
complement(2341)-t, gdbSNP:66492417
complement(2343)-g, adbSNP:57794451
complement(2354)-t, cdbSNP:114185856
complement(2359)-, cdbSNP:72664229
complement(2366)-g, adbSNP:72653790
complement(2379)-t, cdbSNP:72653791
complement(2396)-t, g, adbSNP:72653792
complement(2405)-g, adbSNP:114246406
complement(2430)-g, adbSNP:142223793
complement(2437)-t, cdbSNP:7500834
complement(2446)-g, cdbSNP:116898670
complement(2456)-dbSNP:
complement(2456)-t, cdbSNP:72653793
complement(2457)-g, adbSNP:72653794
complement(2465)-g, adbSNP:72653795
complement(2469)-t, cdbSNP:72653796
complement(2495)-g, cdbSNP:72653797
complement(2514)-t, cdbSNP:72653798
complement(2515)-g, cdbSNP:138026855
complement(2519)-t, cdbSNP:181794120
complement(2527)-g, adbSNP:9924755
complement(2541)-t, cdbSNP:199990104
complement(2548)-c, adbSNP:72650702
complement(2558)-t, cdbSNP:60990156
complement(2561)-t, cdbSNP:72653703
complement(2567)-t, gdbSNP:201884545
complement(2569)-g, cdbSNP:142701023
complement(2579)-t, cdbSNP:6416668
complement(2589)-t, cdbSNP:72653799
complement(2639)-dbSNP:
complement(2639)-t, cdbSNP:114349489
complement(2664)-t, cdbSNP:149081681
complement(2665)-t, gdbSNP:115379860
complement(2668)-c, adbSNP:72664285
complement(2680)-t, gdbSNP:72653800
complement(2687)-t, cdbSNP:138049574
complement(2696)-t, cdbSNP:59206042
complement(2697)-t, cdbSNP:201334880
complement(2699)-t, cdbSNP:115167678
complement(2732)-dbSNP:
complement(2732)-g, c, adbSNP:11861980
complement(2733)-t, cdbSNP:116355959
complement(2738)-t, cdbSNP:111437625
complement(2744)-g, cdbSNP:60712230
complement(2794)-t, cdbSNP:140467297
complement(2818)-g, adbSNP:61731973
complement(2819)-t, cdbSNP:142470921
complement(2851)-dbSNP:
complement(2851)-g, cdbSNP:72653704
complement(2857)-t, gdbSNP:72664286
complement(2868)-t, cdbSNP:72653801
complement(2872..2887)-, cctctgcctctacgcadbSNP:74315152
complement(2872)-g, adbSNP:2856585
complement(2873)-c, adbSNP:61340537
complement(2885)-g, adbSNP:72657689
complement(2886)-g, adbSNP:190557767
complement(2892)-t, gdbSNP:72657690
complement(2895)-t, adbSNP:72657700
complement(2900)-t, gdbSNP:142377854
complement(2928)-g, cdbSNP:72657691
complement(2941)-g, adbSNP:72664287
complement(2958)-t, cdbSNP:147391297
complement(2959)-t, gdbSNP:149243229
complement(2983)-t, cdbSNP:138410013
complement(3011)-g, cdbSNP:72657692
complement(3019)-g, adbSNP:113270297
complement(3078)-dbSNP:
complement(3078)-g, adbSNP:150583228
complement(3101)-g, cdbSNP:57179857
complement(3125)-t, cdbSNP:72653705
complement(3143..3145)-, tttdbSNP:72664230
complement(3155)-g, adbSNP:148064788
complement(3176)-g, adbSNP:199571237
complement(3182)-t, gdbSNP:72657693
complement(3198)-t, gdbSNP:145411106
complement(3205)-c, adbSNP:72657694
complement(3225)-t, gdbSNP:72657695
complement(3227)-g, adbSNP:41278174
complement(3244)-t, c, adbSNP:60975032
complement(3288)-t, gdbSNP:199637421
complement(3326)-t, gdbSNP:60707953
complement(3377)-dbSNP:
complement(3377)-t, cdbSNP:63749794
complement(3378)-g, c, adbSNP:63750427
complement(3380..3382)-, ttgdbSNP:72664231
complement(3399)-t, g, cdbSNP:63750987
complement(3400)-t, cdbSNP:145693403
complement(3401)-, tdbSNP:72664232
complement(3412)-g, adbSNP:115364698
complement(3417)-t, cdbSNP:63749998
complement(3418)-g, adbSNP:63750758
complement(3426)-t, cdbSNP:63750459
complement(3427)-t, cdbSNP:149775493
complement(3434)-t, gdbSNP:63749807
complement(3435)-g, cdbSNP:63750473
complement(3449)-t, cdbSNP:28939701
complement(3450)-g, c, adbSNP:60791294
complement(3452)-g, adbSNP:63750146
complement(3458)-t, cdbSNP:72653706
complement(3464)-t, cdbSNP:72653743
complement(3468)-g, adbSNP:145553069
complement(3496)-t, cdbSNP:59030767
complement(3497)-t, cdbSNP:147794514
complement(3525)-g, adbSNP:142128765
complement(3526)-t, cdbSNP:202000035
complement(3527)-t, cdbSNP:72653744
complement(3528)-g, adbSNP:63750457
complement(3539)-g, cdbSNP:143854720
complement(3579)-dbSNP:
complement(3579)-t, cdbSNP:114928628
complement(3594)-t, gdbSNP:149460452
complement(3601)-g, adbSNP:58494932
complement(3602)-g, adbSNP:139406431
complement(3612)-g, adbSNP:201087449
complement(3623)-g, cdbSNP:146284800
complement(3629)-t, cdbSNP:114920767
complement(3637)-g, adbSNP:200132882
complement(3645)-g, adbSNP:63750607
complement(3689)-dbSNP:
complement(3689)-t, adbSNP:114017587
complement(3698)-t, cdbSNP:63751215
complement(3699)-g, adbSNP:63751001
complement(3705)-g, adbSNP:72653745
complement(3713)-c, adbSNP:63750125
complement(3728)-t, cdbSNP:141728905
complement(3740)-t, cdbSNP:63750402
complement(3741)-t, cdbSNP:138700741
complement(3746)-t, cdbSNP:72653746
complement(3749)-g, cdbSNP:63749796
complement(3752)-t, cdbSNP:63749992
complement(3754)-t, gdbSNP:72653747
complement(3755)-c, adbSNP:150145577
complement(3759)-g, adbSNP:72653748
complement(3760)-g, cdbSNP:72657701
complement(3762)-g, adbSNP:141449320
3772+a, g, tdbSNP:281865557
complement(3776)-dbSNP:
complement(3776)-t, gdbSNP:199694536
complement(3777)-g, cdbSNP:200242428
complement(3788)-g, adbSNP:148326870
complement(3792)-g, adbSNP:143212758
complement(3806..3807)-, cdbSNP:72664220
complement(3811..3812)-, cdbSNP:72664221
complement(3812)-, tdbSNP:72664233
complement(3815)-g, cdbSNP:149151337
complement(3832)-g, adbSNP:114175094
complement(3840)-g, adbSNP:2238472
complement(3855)-g, adbSNP:63750209
complement(3858..3905)-dbSNP:74315128
complement(3860)-t, cdbSNP:72653749
complement(3861)-t, cdbSNP:200010958
complement(3873)-g, adbSNP:77913024
complement(3874)-g, adbSNP:61294695
complement(3889)-t, cdbSNP:56982924
complement(3890)-t, cdbSNP:141731889
complement(3908)-g, adbSNP:58694313
complement(3914)-g, adbSNP:63750625
complement(3917..3919)-, aagdbSNP:72664235
complement(3929)-dbSNP:
complement(3929)-t, g, adbSNP:63751325
complement(3932)-g, adbSNP:63750446
complement(3939)-t, cdbSNP:63750494
complement(3940)-g, adbSNP:201812902
complement(3941)-g, adbSNP:63749856
complement(3944)-g, c, adbSNP:63750410
complement(3949)-, gdbSNP:72664236
complement(3956)-t, cdbSNP:63751318
complement(3969)-g, adbSNP:63750992
complement(3977)-t, cdbSNP:63750759
complement(3978)-g, adbSNP:63751086
complement(3998)-g, adbSNP:63749823
complement(4008)-g, adbSNP:72653750
complement(4015)-t, cdbSNP:57499803
complement(4016)-t, cdbSNP:79536709
complement(4017)-g, adbSNP:57695665
complement(4025)-c, adbSNP:58902671
complement(4033)-t, cdbSNP:60320257
complement(4034)-t, cdbSNP:142505247
complement(4036)-g, adbSNP:63750235
complement(4039)-g, cdbSNP:139128550
complement(4041)-t, c, adbSNP:63750414
complement(4045)-g, adbSNP:146265944
complement(4048)-c, adbSNP:58259232
complement(4052)-t, cdbSNP:28939702
complement(4053)-t, g, adbSNP:63750622
complement(4062)-t, cdbSNP:63750608
complement(4073)-t, cdbSNP:63751112
complement(4078)-g, cdbSNP:63751111
complement(4078)-g, cdbSNP:67720869
complement(4085)-dbSNP:
complement(4085)-c, adbSNP:72664288
complement(4087)-g, adbSNP:141821068
complement(4097)-g, cdbSNP:63750018
complement(4106)-t, cdbSNP:63750428
complement(4107)-t, cdbSNP:201275608
complement(4118)-t, cdbSNP:58695352
complement(4123)-t, cdbSNP:139978668
complement(4138)-t, cdbSNP:200834294
complement(4141)-g, adbSNP:199668617
complement(4141)-, cdbSNP:72664237
complement(4142)-g, adbSNP:60285147
complement(4219)-t, gdbSNP:63750798
complement(4219)-, gdbSNP:67791546
complement(4229)-g, adbSNP:66913554
complement(4230)-t, cdbSNP:202080984
complement(4234)-g, adbSNP:199770983
complement(4235)-g, adbSNP:63751241
complement(4246)-dbSNP:
complement(4246)-c, adbSNP:63750700
complement(4247)-t, cdbSNP:200485267
complement(4255)-g, cdbSNP:149510465
complement(4256..4257)-, agaadbSNP:72664222
complement(4284)-t, gdbSNP:58626288
complement(4289)-t, c, adbSNP:59588658
complement(4290)-g, adbSNP:63751262
complement(4291)-g, adbSNP:58668703
complement(4308)-t, cdbSNP:63750295
complement(4311)-g, adbSNP:150230403
complement(4338)-g, adbSNP:199950526
complement(4342)-t, cdbSNP:72664289
complement(4343..4349)-, acggagcdbSNP:74315109
complement(4351)-g, adbSNP:61553825
complement(4355)-, adbSNP:72664238
complement(4364)-t, cdbSNP:143822047
complement(4372)-, gdbSNP:72664239
complement(4412)-g, adbSNP:72547524
complement(4414)-t, cdbSNP:63750763
complement(4419)-g, adbSNP:57288618
complement(4457)-dbSNP:
complement(4457)-t, adbSNP:72653751
complement(4462)-t, cdbSNP:114099077
complement(4471)-, adbSNP:72664280
complement(4478)-g, adbSNP:63751279
complement(4485)-t, cdbSNP:63750135
complement(4510)-g, adbSNP:141860096
complement(4538)-g, adbSNP:63750874
complement(4574)-c, adbSNP:190110936
complement(4649)-t, cdbSNP:147308589
complement(4701)-t, cdbSNP:149116500
complement(4713)-c, adbSNP:141192278
complement(4769)-g, adbSNP:138073543
complement(4802)-t, cdbSNP:148226174
complement(4864)-t, cdbSNP:212096
complement(4997)-g, adbSNP:141291712
complement(5007)-g, cdbSNP:75141580
complement(5032)-t, cdbSNP:144303704
Gene SymbolABCC6
Gene SynonymABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Chromosome16
Locus Map16p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001079528 Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, mRNA. On-demand $299.00 14
NM_001171 Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 1, mRNA. On-demand $2699.00 30
Title ABCC6 expression is regulated by CCAAT/enhancer-binding protein activating a primate-specific sequence located in the first intron of the gene .
Author Ratajewski,M., de Boussac,H., Sachrajda,I., Bacquet,C., Kovacs,T., Varadi,A., Pulaski,L. and Aranyi,T.
Journal J. Invest. Dermatol. 132 (12), 2709-2717 (2012)
Title Genetics in arterial calcification: lessons learned from rare diseases .
Author Nitschke,Y. and Rutsch,F.
Journal Trends Cardiovasc. Med. 22 (6), 145-149 (2012)
Title Generalized arterial calcification of infancy and pseudoxanthoma elasticum can be caused by mutations in either ENPP1 or ABCC6 .
Author Nitschke,Y., Baujat,G., Botschen,U., Wittkampf,T., du Moulin,M., Stella,J., Le Merrer,M., Guest,G., Lambot,K., Tazarourte-Pinturier,M.F., Chassaing,N., Roche,O., Feenstra,I., Loechner,K., Deshpande,C., Garber,S.J., Chikarmane,R., Steinmann,B., Shahinyan,T., Martorell,L., Davies,J., Smith,W.E., Kahler,S.G., McCulloch,M., Wraige,E., Loidi,L., Hohne,W., Martin,L., Hadj-Rabia,S., Terkeltaub,R. and Rutsch,F.
Journal Am. J. Hum. Genet. 90 (1), 25-39 (2012)
Title Copy number variations of the ATP-binding cassette transporter ABCC6 gene and its pseudogenes .
Author Kringen,M.K., Stormo,C., Grimholt,R.M., Berg,J.P. and Piehler,A.P.
Journal BMC Res Notes 5, 425 (2012)
Title The gene family of ABC transporters--novel mutations, new phenotypes .
Author Uitto,J.
Journal Trends Mol Med 11 (8), 341-343 (2005)
Title MOAT-E (ARA) is a full-length MRP/cMOAT subfamily transporter expressed in kidney and liver .
Author Belinsky,M.G. and Kruh,G.D.
Journal Br. J. Cancer 80 (9), 1342-1349 (1999)
Title The anthracycline resistance-associated (ara) gene, a novel gene associated with multidrug resistance in a human leukaemia cell line .
Author Longhurst,T.J., O'Neill,G.M., Harvie,R.M. and Davey,R.A.
Journal Br. J. Cancer 74 (9), 1331-1335 (1996)
Title Characterization of the human ABC superfamily: isolation and mapping of 21 new genes using the expressed sequence tags database .
Author Allikmets,R., Gerrard,B., Hutchinson,A. and Dean,M.
Journal Hum. Mol. Genet. 5 (10), 1649-1655 (1996)
Title Pseudoxanthoma elasticum .
Author Neldner,K.H.
Journal Clin. Dermatol. 6 (1), 1-159 (1988)
Title Autosomal dominant pseudoxanthoma elasticum .
Author Pope,F.M.
Journal J. Med. Genet. 11 (2), 152-157 (1974)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.