• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001171 Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_001171.5, 190343022
Length 5125 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 1, mRNA.
Product multidrug resistance-associated protein 6 isoform 1
Comment

Summary: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and it encodes the longer protein (isoform 1).

RefSeq NP_001162.4
CDS 38..4549
Misc Feature(1)77..4543
Misc Feature(2)77..4543
Misc Feature(3)131..193
Misc Feature(4)254..316
Misc Feature(5)332..394
Misc Feature(6)431..484
Misc Feature(7)539..601
Misc Feature(8)944..1006
Misc Feature(9)968..1771
Misc Feature(10)1085..1147
Misc Feature(11)1316..1378
Misc Feature(12)1388..1450
Misc Feature(13)1637..1699
Misc Feature(14)1763..1825
Misc Feature(15)1922..2524
Misc Feature(16)2024..2047
Misc Feature(17)order(2033..2038,2042..2050,2129..2131,2366..2371,
Misc Feature(18)2120..2131
Misc Feature(19)2294..2323
Misc Feature(20)2354..2371
Misc Feature(21)2378..2389
Misc Feature(22)2459..2479
Misc Feature(23)2855..2917
Misc Feature(24)2873..3685
Misc Feature(25)3029..3091
Misc Feature(26)3221..3283
Misc Feature(27)3287..3349
Misc Feature(28)3563..3625
Misc Feature(29)3632..3694
Misc Feature(30)3824..4486
Exon (1)1..73
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (2)74..256
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (3)257..382
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (4)383..511
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (5)512..637
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (6)638..699
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (7)700..831
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (8)832..1035
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (9)1036..1213
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (10)1214..1375
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (11)1376..1468
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (12)1469..1672
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (13)1673..1816
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (14)1817..1904
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (15)1905..1980
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (16)1981..2107
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (17)2108..2284
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (18)2285..2452
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (19)2453..2627
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (20)2628..2703
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (21)2704..2824
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (22)2825..3032
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (23)3033..3343
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (24)3344..3543
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (25)3544..3670
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (26)3671..3772
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (27)3773..3919
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (28)3920..4078
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (29)4079..4245
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (30)4246..4440
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Exon (31)4441..5117
Gene:ABCC6
Gene Synonym:ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Translation MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGR GYLRMSPLFKAKMVLGFALIVLCTSSVAVALWKIQQGTPEAPEFLIHPTVWLTTMSFAVF LIHTERKKGVQSSGVLFGYWLLCFVLPATNAAQQASGAGFQSDPVRHLSTYLCLSLVVAQ FVLSCLADQPPFFPEDPQQSNPCPETGAAFPSKATFWWVSGLVWRGYRRPLRPKDLWSLG RENSSEELVSRLEKEWMRNRSAARRHNKAIAFKRKGGSGMKAPETEPFLRQEGSQWRPLL KAIWQVFHSTFLLGTLSLIISDVFRFTVPKLLSLFLEFIGDPKPPAWKGYLLAVLMFLSA CLQTLFEQQNMYRLKVLQMRLRSAITGLVYRKVLALSSGSRKASAVGDVVNLVSVDVQRL TESVLYLNGLWLPLVWIVVCFVYLWQLLGPSALTAIAVFLSLLPLNFFISKKRNHHQEEQ MRQKDSRARLTSSILRNSKTIKFHGWEGAFLDRVLGIRGQELGALRTSGLLFSVSLVSFQ VSTFLVALVVFAVHTLVAENAMNAEKAFVTLTVLNILNKAQAFLPFSIHSLVQARVSFDR LVTFLCLEEVDPGVVDSSSSGSAAGKDCITIHSATFAWSQESPPCLHRINLTVPQGCLLA VVGPVGAGKSSLLSALLGELSKVEGFVSIEGAVAYVPQEAWVQNTSVVENVCFGQELDPP WLERVLEACALQPDVDSFPEGIHTSIGEQGMNLSGGQKQRLSLARAVYRKAAVYLLDDPL AALDAHVGQHVFNQVIGPGGLLQGTTRILVTHALHILPQADWIIVLANGAIAEMGSYQEL LQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRT TSEAQTEVPLDDPDRAGWPAGKDSIQYGRVKATVHLAYLRAVGTPLCLYALFLFLCQQVA SFCRGYWLSLWADDPAVGGQQTQAALRGGIFGLLGCLQAIGLFASMAAVLLGGARASRLL FQRLLWDVVRSPISFFERTPIGHLLNRFSKETDTVDVDIPDKLRSLLMYAFGLLEVSLVV AVATPLATVAILPLFLLYAGFQSLYVVSSCQLRRLESASYSSVCSHMAETFQGSTVVRAF RTQAPFVAQNNARVDESQRISFPRLVADRWLAANVELLGNGLVFAAATCAVLSKAHLSAG LVGFSVSAALQVTQTLQWVVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWP QGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAE GGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQL KALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQM QAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQES GLV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(104)-dbSNP:
complement(104)-c, adbSNP:371804833
142+, adbSNP:72664223
150+c, gdbSNP:72653752
complement(199)-t, gdbSNP:374115365
complement(200)-t, cdbSNP:372062746
complement(204)-t, cdbSNP:367832780
complement(207)-t, cdbSNP:374778258
complement(214)-g, adbSNP:371336666
complement(216)-t, cdbSNP:183648123
219+a, gdbSNP:72657696
257..259+dbSNP:
257..259+, gtgdbSNP:72664225
423+dbSNP:
423+a, gdbSNP:72653753
complement(429)-t, cdbSNP:369280729
487..488+, cdbSNP:387906860
510+c, tdbSNP:2606921
complement(511)-t, cdbSNP:376219152
complement(524)-dbSNP:
complement(524)-t, cdbSNP:192110266
complement(533)-g, adbSNP:201766106
586+a, gdbSNP:72664281
656+dbSNP:
656+a, gdbSNP:72657697
682+a, gdbSNP:72664282
691+g, tdbSNP:72653754
713+dbSNP:
713+a, gdbSNP:72653755
complement(743)-t, gdbSNP:372211360
761+g, tdbSNP:72650697
complement(788)-g, adbSNP:199645691
791+c, tdbSNP:72653757
complement(827)-g, adbSNP:376409933
complement(830)-t, cdbSNP:78629019
complement(838)-dbSNP:
complement(838)-t, gdbSNP:368547779
complement(851)-g, adbSNP:199534175
complement(863)-t, cdbSNP:200051606
complement(866)-t, cdbSNP:201615561
complement(877)-g, cdbSNP:371480297
complement(892)-g, adbSNP:4780605
complement(897)-g, cdbSNP:376822399
902..926+, ctacggcaagaagggagccagtggcdbSNP:74315139
complement(905)-g, adbSNP:200330935
complement(916)-g, cdbSNP:375066891
complement(927)-t, cdbSNP:199729978
975..976+, tdbSNP:72664216
988+a, c, gdbSNP:78678589
992+a, gdbSNP:72657699
997+, cdbSNP:72664226
complement(1012)-t, cdbSNP:375845144
complement(1030)-c, adbSNP:146523238
complement(1058)-dbSNP:
complement(1058)-g, cdbSNP:145232796
complement(1093)-g, adbSNP:200738286
complement(1095)-g, adbSNP:369074083
complement(1096)-g, adbSNP:150016641
complement(1097)-t, cdbSNP:372132926
1101+g, tdbSNP:72653758
complement(1111)-g, adbSNP:139317080
1124..1156+, caaacgctgtttgagcagcagaacatgtacaggdbSNP:387906353
1124+c, tdbSNP:72650698
1125..1157+, aaacgctgtttgagcagcagaacatgtacaggcdbSNP:74315156
1128+c, gdbSNP:72653759
complement(1157)-g, cdbSNP:370022963
1169+c, tdbSNP:72650699
1178+c, tdbSNP:72664284
1181+c, tdbSNP:72653761
complement(1186)-t, cdbSNP:138992331
1213+c, g, tdbSNP:72653763
1229+dbSNP:
1229+a, gdbSNP:72653764
complement(1231)-g, adbSNP:376518465
complement(1232)-t, cdbSNP:368723482
complement(1251)-g, adbSNP:115663615
complement(1270)-g, c, adbSNP:9930886
complement(1280)-t, cdbSNP:200582171
1281+c, tdbSNP:72653765
complement(1282)-t, cdbSNP:9940825
complement(1285)-g, adbSNP:143487365
complement(1300)-g, adbSNP:114179357
complement(1312)-g, cdbSNP:201682224
complement(1320)-t, cdbSNP:201880691
1321+c, tdbSNP:57499497
complement(1348)-t, gdbSNP:150075392
1355+g, tdbSNP:72653766
complement(1357)-g, adbSNP:375433102
complement(1360)-g, adbSNP:200519199
complement(1361)-t, cdbSNP:372059636
complement(1365)-t, cdbSNP:142007498
1381+dbSNP:
1381+a, gdbSNP:58703366
complement(1390)-g, adbSNP:57546826
complement(1400)-g, cdbSNP:67996819
complement(1405)-g, adbSNP:141309818
complement(1411)-g, adbSNP:370494121
1425+a, tdbSNP:72653767
complement(1461)-t, adbSNP:151187637
complement(1472)-dbSNP:
complement(1472)-t, cdbSNP:368746151
complement(1496)-g, cdbSNP:374244303
1497+a, gdbSNP:72653768
1521+a, tdbSNP:72653769
1528+a, cdbSNP:72653770
complement(1536)-g, adbSNP:372045804
1542+a, tdbSNP:72653771
complement(1554)-t, cdbSNP:151130276
complement(1556)-g, cdbSNP:368017088
complement(1577)-t, cdbSNP:59157279
1589+c, tdbSNP:72650700
1590+a, gdbSNP:72653772
complement(1604)-t, cdbSNP:374546971
complement(1606)-t, gdbSNP:145764775
complement(1607)-t, cdbSNP:143588929
1611..1612+, gdbSNP:72664217
complement(1622)-t, cdbSNP:140045277
complement(1623)-t, cdbSNP:199643353
complement(1637)-c, adbSNP:199634124
1640+c, tdbSNP:72653773
1676+dbSNP:
1676+a, gdbSNP:56877937
1689+c, tdbSNP:72653774
complement(1712)-t, cdbSNP:114149656
1722+c, tdbSNP:72653775
complement(1736)-t, cdbSNP:143092672
complement(1738)-g, cdbSNP:376767639
complement(1740)-g, adbSNP:66864704
complement(1745)-t, gdbSNP:369358409
complement(1768)-g, adbSNP:139771750
complement(1808)-g, cdbSNP:201193903
complement(1811)-t, cdbSNP:190761354
1818+dbSNP:
1818+c, tdbSNP:72653776
complement(1820)-g, adbSNP:150866831
1835+c, tdbSNP:72653777
1852+c, tdbSNP:61318127
complement(1874)-t, cdbSNP:369816256
1875+g, tdbSNP:72653778
complement(1878)-g, adbSNP:12931472
complement(1879)-g, adbSNP:375557810
complement(1880)-t, cdbSNP:372235202
complement(1890)-t, cdbSNP:371997398
1894..1895+, cdbSNP:72664218
complement(1918)-dbSNP:
complement(1918)-g, adbSNP:143100448
complement(1927)-g, cdbSNP:8058696
complement(1933)-t, gdbSNP:8058694
1981..2002+dbSNP:
1981..2002+, aataaacctcacggtgccccagdbSNP:74315158
complement(1992)-g, adbSNP:146936233
complement(1993)-t, cdbSNP:141399693
complement(2000)-t, gdbSNP:369410139
2001+a, gdbSNP:72653779
2004..2026+, gctgtctgctggctgttgtcggtdbSNP:74315130
2024+g, tdbSNP:72653780
complement(2031)-g, adbSNP:4341770
2032+, gdbSNP:72664227
2033+g, tdbSNP:72653781
2036+, gdbSNP:72664228
complement(2055)-g, adbSNP:67470842
2067+c, tdbSNP:72653782
complement(2084)-c, adbSNP:150128722
complement(2086)-t, cdbSNP:372511255
2095+c, tdbSNP:57866002
complement(2096)-t, cdbSNP:368806440
complement(2104)-g, adbSNP:61266641
complement(2111)-dbSNP:
complement(2111)-t, cdbSNP:151272575
complement(2115)-g, adbSNP:374763280
complement(2116)-t, cdbSNP:189252048
complement(2118)-g, adbSNP:199951066
complement(2122)-g, adbSNP:199913903
complement(2123)-t, cdbSNP:143731811
2130+a, cdbSNP:72653783
2134+g, tdbSNP:72653784
complement(2156)-t, cdbSNP:372121585
complement(2162)-t, cdbSNP:114303883
complement(2168)-t, cdbSNP:200800189
complement(2171)-g, adbSNP:140013237
complement(2176)-g, adbSNP:115546382
complement(2177)-t, cdbSNP:200513114
2199+a, gdbSNP:72650701
complement(2203)-t, cdbSNP:201193229
2214+c, tdbSNP:72653785
complement(2244)-t, cdbSNP:148573422
complement(2282)-g, adbSNP:66616070
2289+dbSNP:
2289+a, tdbSNP:72653786
complement(2299)-g, adbSNP:149822534
2300+a, gdbSNP:72653787
complement(2305)-t, gdbSNP:116633099
2315+c, tdbSNP:72653788
2331+a, g, tdbSNP:67561842
2334+a, cdbSNP:72653789
complement(2341)-t, gdbSNP:66492417
2343+a, gdbSNP:57794451
complement(2354)-t, cdbSNP:114185856
2359+, cdbSNP:72664229
2366+a, gdbSNP:72653790
2379+a, c, tdbSNP:72653791
complement(2405)-g, adbSNP:114246406
complement(2430)-g, adbSNP:142223793
complement(2437)-t, cdbSNP:7500834
complement(2446)-g, cdbSNP:116898670
2456+dbSNP:
2456+c, tdbSNP:72653793
2457+a, gdbSNP:72653794
2465+a, gdbSNP:72653795
2469+c, tdbSNP:72653796
complement(2473)-g, adbSNP:374490625
complement(2479)-t, gdbSNP:372714722
2495+c, gdbSNP:72653797
2514+c, tdbSNP:72653798
complement(2515)-g, cdbSNP:138026855
complement(2519)-t, cdbSNP:181794120
complement(2527)-g, adbSNP:9924755
complement(2529)-t, adbSNP:370039769
complement(2541)-t, cdbSNP:199990104
2548+a, cdbSNP:72650702
2558+c, tdbSNP:60990156
2561+c, tdbSNP:72653703
complement(2567)-t, gdbSNP:201884545
complement(2569)-g, cdbSNP:142701023
2579+, adbSNP:67867306
complement(2579)-t, cdbSNP:6416668
2589+c, tdbSNP:72653799
complement(2602)-t, cdbSNP:375979955
complement(2636)-dbSNP:
complement(2636)-g, adbSNP:376512808
complement(2639)-t, cdbSNP:114349489
complement(2664)-t, cdbSNP:149081681
complement(2665)-t, gdbSNP:115379860
2668+a, cdbSNP:72664285
complement(2672)-t, cdbSNP:377008733
2680+g, tdbSNP:72653800
complement(2686)-g, adbSNP:373335815
complement(2687)-t, cdbSNP:138049574
2696+c, tdbSNP:59206042
complement(2697)-t, cdbSNP:201334880
complement(2698)-g, adbSNP:376958386
complement(2699)-t, cdbSNP:115167678
complement(2732)-dbSNP:
complement(2732)-g, c, adbSNP:11861980
complement(2733)-t, cdbSNP:116355959
complement(2738)-t, cdbSNP:111437625
2744+c, gdbSNP:60712230
complement(2754)-g, cdbSNP:375890241
complement(2794)-t, cdbSNP:140467297
complement(2818)-g, adbSNP:61731973
complement(2819)-t, cdbSNP:142470921
complement(2825)-dbSNP:
complement(2825)-c, adbSNP:375196952
2851+c, gdbSNP:72653704
2857..2858+, cdbSNP:72664219
2857+g, tdbSNP:72664286
complement(2861)-t, cdbSNP:375592383
2868+c, tdbSNP:72653801
2872..2887+, cctctgcctctacgcadbSNP:74315152
complement(2872)-g, adbSNP:2856585
2885+a, gdbSNP:72657689
complement(2886)-g, adbSNP:190557767
2892+g, tdbSNP:72657690
2895+a, tdbSNP:72657700
complement(2900)-t, gdbSNP:142377854
2928+c, gdbSNP:72657691
complement(2958)-t, cdbSNP:147391297
complement(2980)-t, cdbSNP:368465318
complement(2983)-t, cdbSNP:138410013
complement(2997)-t, cdbSNP:374113337
complement(3010)-g, adbSNP:375767696
3011+c, gdbSNP:72657692
complement(3019)-g, adbSNP:113270297
complement(3061)-dbSNP:
complement(3061)-t, cdbSNP:372041663
complement(3078)-g, adbSNP:150583228
complement(3081)-t, cdbSNP:373863345
complement(3091)-t, cdbSNP:370805624
3101+c, gdbSNP:57179857
complement(3112)-t, cdbSNP:376087244
3125+c, tdbSNP:72653705
complement(3126)-t, cdbSNP:374451029
3143..3145+, tttdbSNP:72664230
complement(3150)-t, cdbSNP:371211631
complement(3155)-g, adbSNP:148064788
complement(3176)-g, adbSNP:199571237
3182+g, tdbSNP:72657693
complement(3198)-t, gdbSNP:145411106
complement(3199)-t, cdbSNP:374140753
3205+a, cdbSNP:72657694
complement(3221)-t, cdbSNP:377653646
3225+g, tdbSNP:72657695
complement(3227)-g, adbSNP:41278174
complement(3245)-t, cdbSNP:369518454
complement(3276)-g, adbSNP:374864191
complement(3287..3288)-, tdbSNP:371101978
complement(3288)-t, gdbSNP:199637421
complement(3326)-t, gdbSNP:60707953
complement(3329)-g, adbSNP:377480088
complement(3331)-g, adbSNP:371889155
3378+dbSNP:
3378+a, c, gdbSNP:63750427
3380..3382+, ttgdbSNP:72664231
3399+c, g, tdbSNP:63750987
complement(3400)-t, cdbSNP:145693403
3401+, tdbSNP:72664232
complement(3412)-g, adbSNP:115364698
3417+c, tdbSNP:63749998
3418+a, gdbSNP:63750758
3426+c, tdbSNP:63750459
complement(3427)-t, cdbSNP:149775493
3434+g, tdbSNP:63749807
3435+c, gdbSNP:63750473
3450+a, c, gdbSNP:60791294
3452+a, gdbSNP:63750146
3464+c, tdbSNP:72653743
complement(3468)-g, adbSNP:145553069
3496+c, tdbSNP:59030767
complement(3497)-t, cdbSNP:147794514
complement(3525)-g, adbSNP:142128765
complement(3526)-t, cdbSNP:202000035
3528+a, gdbSNP:63750457
complement(3539)-g, cdbSNP:143854720
complement(3561)-dbSNP:
complement(3561)-g, adbSNP:376062004
complement(3579)-t, cdbSNP:114928628
complement(3583)-t, cdbSNP:372578623
complement(3594)-t, gdbSNP:149460452
3601+a, gdbSNP:58494932
complement(3612)-g, adbSNP:201087449
complement(3623)-g, cdbSNP:146284800
complement(3629)-t, cdbSNP:114920767
complement(3637)-g, adbSNP:200132882
3645+a, gdbSNP:63750607
complement(3653)-t, cdbSNP:375983928
complement(3686)-dbSNP:
complement(3686)-t, gdbSNP:371493792
complement(3689)-t, adbSNP:114017587
complement(3697)-g, adbSNP:371191765
3698+c, tdbSNP:63751215
3699+a, gdbSNP:63751001
3705+a, gdbSNP:72653745
3713+a, cdbSNP:63750125
complement(3727)-g, adbSNP:368931767
complement(3728)-t, cdbSNP:141728905
3740+c, tdbSNP:63750402
complement(3741)-t, cdbSNP:138700741
3746+c, tdbSNP:72653746
3749+c, gdbSNP:63749796
3752+c, tdbSNP:63749992
3754+g, tdbSNP:72653747
complement(3755)-c, adbSNP:150145577
3759+a, gdbSNP:72653748
3760+c, gdbSNP:72657701
complement(3762)-g, adbSNP:141449320
3772+a, g, tdbSNP:281865557
complement(3776)-dbSNP:
complement(3776)-t, gdbSNP:199694536
complement(3777)-g, cdbSNP:200242428
complement(3788)-g, adbSNP:148326870
complement(3792)-g, adbSNP:143212758
complement(3797)-t, cdbSNP:375647381
3806..3807+, cdbSNP:72664220
3811..3812+, cdbSNP:72664221
3812+, tdbSNP:72664233
complement(3815)-g, cdbSNP:149151337
complement(3832)-g, adbSNP:114175094
3835+, gdbSNP:72664234
complement(3839)-g, adbSNP:368379895
complement(3840)-t, cdbSNP:386562149
3855+a, gdbSNP:63750209
3858..3905+dbSNP:74315128
3860+c, tdbSNP:72653749
complement(3861)-t, cdbSNP:200010958
complement(3873)-g, adbSNP:77913024
3874+a, gdbSNP:61294695
3889+c, tdbSNP:56982924
complement(3890)-t, cdbSNP:141731889
complement(3909)-t, gdbSNP:369871412
3914+a, gdbSNP:63750625
3917..3919+, aagdbSNP:72664235
complement(3919)-t, cdbSNP:376851894
complement(3924)-dbSNP:
complement(3924)-t, cdbSNP:374086268
complement(3928)-g, adbSNP:375741855
3932+a, gdbSNP:63750446
3939+c, tdbSNP:63750494
complement(3940)-g, adbSNP:201812902
3941+a, gdbSNP:63749856
3944+a, c, gdbSNP:63750410
3949+, gdbSNP:72664236
3956+c, tdbSNP:63751318
3969+a, gdbSNP:63750992
complement(3976)-t, cdbSNP:371122759
3977+c, tdbSNP:63750759
3978+a, gdbSNP:63751086
3998+a, gdbSNP:63749823
4008+a, gdbSNP:72653750
4015+c, tdbSNP:57499803
complement(4016)-t, cdbSNP:79536709
4017+a, gdbSNP:57695665
4025+a, cdbSNP:58902671
4033+c, tdbSNP:60320257
complement(4034)-t, cdbSNP:142505247
4036+a, gdbSNP:63750235
complement(4039)-g, cdbSNP:139128550
4041+a, c, tdbSNP:63750414
complement(4043)-t, gdbSNP:376735995
complement(4045)-g, adbSNP:146265944
4048+a, cdbSNP:58259232
4052+a, c, tdbSNP:28939702
4053+a, g, tdbSNP:63750622
4062+c, tdbSNP:63750608
4070+c, gdbSNP:63749800
4073+c, tdbSNP:63751112
4078+c, gdbSNP:63751111
4085+dbSNP:
4085+a, cdbSNP:72664288
complement(4087)-g, adbSNP:141821068
4097+c, gdbSNP:63750018
4106+c, tdbSNP:63750428
complement(4107)-t, cdbSNP:201275608
complement(4118)-t, cdbSNP:58695352
complement(4123)-t, cdbSNP:139978668
complement(4138)-t, cdbSNP:200834294
4141+, cdbSNP:72664237
complement(4141)-g, adbSNP:199668617
4142+a, gdbSNP:60285147
complement(4144)-t, cdbSNP:375386682
complement(4167)-g, adbSNP:371122482
complement(4177)-g, adbSNP:368258006
complement(4201)-g, adbSNP:373736094
4219+, gdbSNP:67791546
4219+g, tdbSNP:63750798
complement(4229)-g, adbSNP:66913554
complement(4230)-t, cdbSNP:202080984
complement(4234)-g, adbSNP:199770983
4235+a, gdbSNP:63751241
4246+dbSNP:
4246+a, cdbSNP:63750700
complement(4247)-t, cdbSNP:200485267
4253+a, cdbSNP:387906859
complement(4255)-g, cdbSNP:149510465
4256..4257+, agaadbSNP:72664222
4280..4281+, agaadbSNP:387906352
4284+g, tdbSNP:58626288
4289+a, c, tdbSNP:59588658
4290+a, c, gdbSNP:63751262
4308+c, tdbSNP:63750295
complement(4311)-g, adbSNP:150230403
complement(4315)-g, adbSNP:376210462
complement(4323)-g, adbSNP:374236964
complement(4338)-g, adbSNP:199950526
4342+c, tdbSNP:72664289
4343..4349+, acggagcdbSNP:74315109
4351+a, gdbSNP:61553825
4355+, adbSNP:72664238
complement(4364)-t, cdbSNP:143822047
4372+, gdbSNP:72664239
complement(4402)-g, adbSNP:369157557
complement(4408)-g, adbSNP:376955544
complement(4411)-g, adbSNP:371710180
complement(4412)-g, adbSNP:72547524
4414+c, tdbSNP:63750763
4419+a, gdbSNP:57288618
4457+dbSNP:
4457+a, tdbSNP:72653751
complement(4462)-t, cdbSNP:114099077
4471+, adbSNP:72664280
4478+a, gdbSNP:63751279
complement(4510)-g, adbSNP:141860096
4538+a, gdbSNP:63750874
complement(4540)-g, adbSNP:368798086
complement(4566)-t, cdbSNP:3902401
complement(4574)-c, adbSNP:190110936
complement(4583)-t, cdbSNP:377695659
complement(4649)-t, cdbSNP:147308589
complement(4701)-t, cdbSNP:149116500
complement(4713)-c, adbSNP:141192278
complement(4769)-g, adbSNP:138073543
complement(4802)-t, cdbSNP:148226174
complement(4864)-t, cdbSNP:212096
complement(4997)-g, adbSNP:141291712
complement(5007)-g, cdbSNP:75141580
complement(5032)-t, cdbSNP:144303704
complement(5111)-t, cdbSNP:372646191
Gene SymbolABCC6
Gene SynonymABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7
Chromosome16
Locus Map16p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001079528 Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, mRNA. On-demand $299.00 14
NM_001171 Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 1, mRNA. On-demand $2699.00 30
XM_006725193 PREDICTED: Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant X2, mRNA. On-demand $899.00 20
XM_006725194 PREDICTED: Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant X3, mRNA. On-demand $899.00 20
XM_005255310 PREDICTED: Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant X1, mRNA. On-demand $899.00 20
Title Mutations in the ABCC6 gene as a cause of generalized arterial calcification of infancy: genotypic overlap with pseudoxanthoma elasticum .
Author Li Q, Brodsky JL, Conlin LK, Pawel B, Glatz AC, Gafni RI, Schurgers L, Uitto J, Hakonarson H, Deardorff MA and Levine MA.
Journal J. Invest. Dermatol. 134 (3), 658-665 (2014)
Title ABCC6 prevents ectopic mineralization seen in pseudoxanthoma elasticum by inducing cellular nucleotide release .
Author Jansen RS, Kucukosmanoglu A, de Haas M, Sapthu S, Otero JA, Hegman IE, Bergen AA, Gorgels TG, Borst P and van de Wetering K.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (50), 20206-20211 (2013)
Title The hepatitis B x antigen anti-apoptotic effector URG7 is localized to the endoplasmic reticulum membrane .
Author Ostuni A, Lara P, Armentano MF, Miglionico R, Salvia AM, Monnich M, Carmosino M, Lasorsa FM, Monne M, Nilsson I and Bisaccia F.
Journal FEBS Lett. 587 (18), 3058-3062 (2013)
Title The gene family of ABC transporters--novel mutations, new phenotypes .
Author Uitto J.
Journal Trends Mol Med 11 (8), 341-343 (2005)
Title MOAT-E (ARA) is a full-length MRP/cMOAT subfamily transporter expressed in kidney and liver .
Author Belinsky MG and Kruh GD.
Journal Br. J. Cancer 80 (9), 1342-1349 (1999)
Title The anthracycline resistance-associated (ara) gene, a novel gene associated with multidrug resistance in a human leukaemia cell line .
Author Longhurst TJ, O'Neill GM, Harvie RM and Davey RA.
Journal Br. J. Cancer 74 (9), 1331-1335 (1996)
Title Characterization of the human ABC superfamily: isolation and mapping of 21 new genes using the expressed sequence tags database .
Author Allikmets R, Gerrard B, Hutchinson A and Dean M.
Journal Hum. Mol. Genet. 5 (10), 1649-1655 (1996)
Title Pseudoxanthoma Elasticum .
Author Terry,S.F. and Bercovitch,L.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Pseudoxanthoma elasticum .
Author Neldner KH.
Journal Clin. Dermatol. 6 (1), 1-159 (1988)
Title Autosomal dominant pseudoxanthoma elasticum .
Author Pope,F.M.
Journal J. Med. Genet. 11 (2), 152-157 (1974)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.