• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001171940 Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $299.00 14

*Business Day

Related Services

RefSeq Version NM_001171940.1, 288541419
Length 2099 bp
Structure linear
Update Date 14-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 3, mRNA.
Product fibronectin type III domain-containing protein 5 isoform 3
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BE502835.1, BX537781.1 and BC033123.1.


Transcript Variant: This variant (3) differs in the 5', UTR, 3' UTR and coding region, compared to variant 1, one of which results in a frameshift. The resulting protein (isoform 3) has a distinct C-terminus and is shorter than isoform 1.


##Evidence-Data-START## Transcript exon combination :: BX537781.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001165411.1
CDS 293..613
Misc Feature(1)<305..439
Misc Feature(2)<305..439
Misc Feature(3)order(356..358,401..403)
Misc Feature(4)order(404..409,413..418)
Exon (1)1..161
Gene:FNDC5
Gene Synonym:FRCP2
Exon (2)162..277
Gene:FNDC5
Gene Synonym:FRCP2
Exon (3)278..476
Gene:FNDC5
Gene Synonym:FRCP2
Exon (4)477..566
Gene:FNDC5
Gene Synonym:FRCP2
Exon (5)567..598
Gene:FNDC5
Gene Synonym:FRCP2
Exon (6)599..2083
Gene:FNDC5
Gene Synonym:FRCP2
Translation MLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKN KDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIEA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(27)-dbSNP:
complement(27)-t, gdbSNP:191621656
complement(28)-g, adbSNP:187247333
complement(184)-dbSNP:
complement(184)-t, gdbSNP:55783359
complement(191)-t, cdbSNP:41265873
complement(300)-t, cdbSNP:140092865
complement(340)-g, adbSNP:149496621
complement(442)-t, cdbSNP:201963189
complement(519)-dbSNP:
complement(519)-t, cdbSNP:137888693
complement(533)-g, adbSNP:138727728
complement(542)-t, cdbSNP:189231805
complement(545)-t, cdbSNP:200824057
complement(588)-dbSNP:
complement(588)-t, cdbSNP:140995767
complement(614)-dbSNP:
complement(614)-g, cdbSNP:186735140
complement(671)-g, adbSNP:72882315
complement(742)-g, adbSNP:41265871
complement(835)-t, adbSNP:182307482
complement(864)-g, adbSNP:192675355
complement(896)-g, adbSNP:111297582
complement(900)-g, adbSNP:111792806
complement(970)-g, adbSNP:41265869
complement(1089)-t, cdbSNP:188449869
complement(1198..1199)-, adbSNP:148383625
complement(1286)-t, cdbSNP:113655390
complement(1464)-t, gdbSNP:74583158
complement(1490)-g, adbSNP:183238750
complement(1542..1543)-, gadbSNP:138570533
complement(1653)-t, gdbSNP:191897980
complement(1660)-g, adbSNP:187740130
complement(1738)-t, cdbSNP:146223915
complement(1766)-t, cdbSNP:183460978
complement(1787)-g, adbSNP:3480
complement(1794)-g, adbSNP:141940806
Gene SymbolFNDC5
Gene SynonymFRCP2
Chromosome1
Locus Map1p35.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001171940 Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 3, mRNA. On-demand $299.00 14
NM_001171941 Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 1, mRNA. In-stock $248.00 $199.00 10
NM_153756 Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 2, mRNA. In-stock $248.00 $199.00 10
Title FNDC5 and irisin in humans: I. Predictors of circulating concentrations in serum and plasma and II. mRNA expression and circulating concentrations in response to weight loss and exercise .
Author Huh,J.Y., Panagiotou,G., Mougios,V., Brinkoetter,M., Vamvini,M.T., Schneider,B.E. and Mantzoros,C.S.
Journal Metab. Clin. Exp. 61 (12), 1725-1738 (2012)
Title A PGC1-alpha-dependent myokine that drives brown-fat-like development of white fat and thermogenesis .
Author Bostrom,P., Wu,J., Jedrychowski,M.P., Korde,A., Ye,L., Lo,J.C., Rasbach,K.A., Bostrom,E.A., Choi,J.H., Long,J.Z., Kajimura,S., Zingaretti,M.C., Vind,B.F., Tu,H., Cinti,S., Hojlund,K., Gygi,S.P. and Spiegelman,B.M.
Journal Nature 481 (7382), 463-468 (2012)
Title Frcp1 and Frcp2, two novel fibronectin type III repeat containing genes .
Author Teufel,A., Malik,N., Mukhopadhyay,M. and Westphal,H.
Journal Gene 297 (1-2), 79-83 (2002)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.