• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001171940 Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001171940.1, 288541419
Length 2099 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 3, mRNA.
Product fibronectin type III domain-containing protein 5 isoform 3 preproprotein
Comment

Summary: This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013].


Transcript Variant: This variant (3) contains multiple differences in the UTRs and coding region, compared to variant 1. It initiates translation from an alternate 'AUA' start codon that is conserved as an 'AUG' start codon in orthologs. The encoded isoform (3) is longer and has distinct N- and C-termini, compared to isoform 1.

RefSeq NP_001165411.2
CDS 68..613
Misc Feature(1)167..439
Misc Feature(2)order(167..169,356..358,401..403)
Misc Feature(3)order(404..409,413..418)
Misc Feature(4)524..586
Exon (1)1..161
Gene:FNDC5
Gene Synonym:FRCP2; irisin
Exon (2)162..277
Gene:FNDC5
Gene Synonym:FRCP2; irisin
Exon (3)278..476
Gene:FNDC5
Gene Synonym:FRCP2; irisin
Exon (4)477..566
Gene:FNDC5
Gene Synonym:FRCP2; irisin
Exon (5)567..598
Gene:FNDC5
Gene Synonym:FRCP2; irisin
Exon (6)599..2083
Gene:FNDC5
Gene Synonym:FRCP2; irisin
Translation MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDE VVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPV LFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIE A
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(27)-dbSNP:
complement(27)-t, gdbSNP:191621656
complement(28)-g, adbSNP:187247333
complement(184)-dbSNP:
complement(184)-t, gdbSNP:55783359
complement(191)-t, cdbSNP:41265873
complement(281)-dbSNP:
complement(281)-t, cdbSNP:368098828
complement(291)-t, cdbSNP:373917435
complement(297)-g, adbSNP:370511876
complement(300)-t, cdbSNP:140092865
complement(305)-t, gdbSNP:375151828
complement(314)-t, cdbSNP:376090198
complement(324)-g, adbSNP:374085063
complement(340)-g, adbSNP:149496621
complement(364)-t, cdbSNP:371060777
complement(418)-g, adbSNP:377691602
complement(442)-t, cdbSNP:201963189
complement(444)-t, cdbSNP:369474610
complement(510)-dbSNP:
complement(510)-t, gdbSNP:370205345
complement(516)-g, adbSNP:377741902
complement(519)-t, cdbSNP:137888693
complement(533)-g, adbSNP:138727728
complement(542)-t, cdbSNP:189231805
complement(545)-t, cdbSNP:200824057
complement(588)-dbSNP:
complement(588)-t, cdbSNP:140995767
complement(614)-dbSNP:
complement(614)-g, cdbSNP:186735140
complement(671)-g, adbSNP:72882315
complement(742)-g, adbSNP:41265871
complement(835)-t, adbSNP:182307482
complement(864)-g, adbSNP:192675355
complement(896)-g, adbSNP:111297582
complement(896)-g, adbSNP:386466941
complement(900)-g, adbSNP:111792806
complement(970)-g, adbSNP:41265869
complement(1089)-t, cdbSNP:188449869
complement(1110)-g, cdbSNP:374096384
complement(1197..1198)-, adbSNP:148383625
complement(1286)-t, cdbSNP:113655390
complement(1379)-t, cdbSNP:372376939
complement(1464)-t, gdbSNP:74583158
complement(1490)-g, adbSNP:183238750
complement(1542..1543)-, gadbSNP:138570533
complement(1653)-t, gdbSNP:191897980
complement(1660)-g, adbSNP:187740130
complement(1738)-t, cdbSNP:146223915
complement(1766)-t, cdbSNP:183460978
complement(1787)-g, adbSNP:3480
complement(1789)-t, cdbSNP:372054809
complement(1794)-g, adbSNP:141940806
Gene SymbolFNDC5
Gene SynonymFRCP2; irisin
Chromosome1
Locus Map1p35.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001171940 Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 3, mRNA. On-demand TBD TBD
NM_001171941 Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 1, mRNA. In-stock $248.00 $199.00 10
NM_153756 Homo sapiens fibronectin type III domain containing 5 (FNDC5), transcript variant 2, mRNA. In-stock $308.00 $259.00 TBD
Title Serum levels of the myokine irisin in relation to metabolic and renal function .
Author Ebert T, Focke D, Petroff D, Wurst U, Richter J, Bachmann A, Lossner U, Kralisch S, Kratzsch J, Beige J, Bast I, Anders M, Bluher M, Stumvoll M and Fasshauer M.
Journal Eur. J. Endocrinol. 170 (4), 501-506 (2014)
Title The identification of irisin in human cerebrospinal fluid: influence of adiposity, metabolic markers, and gestational diabetes .
Author Piya MK, Harte AL, Sivakumar K, Tripathi G, Voyias PD, James S, Sabico S, Al-Daghri NM, Saravanan P, Barber TM, Kumar S, Vatish M and McTernan PG.
Journal Am. J. Physiol. Endocrinol. Metab. 306 (5), E512-E518 (2014)
Title Irisin ERKs the fat .
Author Wu J and Spiegelman BM.
Journal Diabetes 63 (2), 381-383 (2014)
Title The effects of acute and chronic exercise on PGC-1alpha, irisin and browning of subcutaneous adipose tissue in humans .
Author Norheim F, Langleite TM, Hjorth M, Holen T, Kielland A, Stadheim HK, Gulseth HL, Birkeland KI, Jensen J and Drevon CA.
Journal FEBS J. 281 (3), 739-749 (2014)
Title Expression of the irisin precursor FNDC5 in skeletal muscle correlates with aerobic exercise performance in patients with heart failure .
Author Lecker SH, Zavin A, Cao P, Arena R, Allsup K, Daniels KM, Joseph J, Schulze PC and Forman DE.
Journal Circ Heart Fail 5 (6), 812-818 (2012)
Title Beige adipocytes are a distinct type of thermogenic fat cell in mouse and human .
Author Wu J, Bostrom P, Sparks LM, Ye L, Choi JH, Giang AH, Khandekar M, Virtanen KA, Nuutila P, Schaart G, Huang K, Tu H, van Marken Lichtenbelt WD, Hoeks J, Enerback S, Schrauwen P and Spiegelman BM.
Journal Cell 150 (2), 366-376 (2012)
Title Medicine. Irisin, light my fire .
Author Kelly DP.
Journal Science 336 (6077), 42-43 (2012)
Title A PGC1-alpha-dependent myokine that drives brown-fat-like development of white fat and thermogenesis .
Author Bostrom P, Wu J, Jedrychowski MP, Korde A, Ye L, Lo JC, Rasbach KA, Bostrom EA, Choi JH, Long JZ, Kajimura S, Zingaretti MC, Vind BF, Tu H, Cinti S, Hojlund K, Gygi SP and Spiegelman BM.
Journal Nature 481 (7382), 463-468 (2012)
Title Identification of evolutionarily conserved non-AUG-initiated N-terminal extensions in human coding sequences .
Author Ivanov IP, Firth AE, Michel AM, Atkins JF and Baranov PV.
Journal Nucleic Acids Res. 39 (10), 4220-4234 (2011)
Title Frcp1 and Frcp2, two novel fibronectin type III repeat containing genes .
Author Teufel A, Malik N, Mukhopadhyay M and Westphal H.
Journal Gene 297 (1-2), 79-83 (2002)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.