• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ataxia telangiectasia and Rad3 related (ATR), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001184 Homo sapiens ataxia telangiectasia and Rad3 related (ATR), mRNA. GenEZ ORF Cloning On-demand $3749.00 35

*Business Day

Related Services

RefSeq Version NM_001184.3, 157266316
Length 8258 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ataxia telangiectasia and Rad3 related (ATR), mRNA.
Product serine/threonine-protein kinase ATR
Comment

Summary: The protein encoded by this gene belongs the PI3/PI4-kinase family, and is most closely related to ATM, a protein kinase encoded by the gene mutated in ataxia telangiectasia. This protein and ATM share similarity with Schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This kinase has been shown to phosphorylate checkpoint kinase CHK1, checkpoint proteins RAD17, and RAD9, as well as tumor suppressor protein BRCA1. Mutations of this gene are associated with Seckel syndrome. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq, Jul 2008].

RefSeq NP_001175.2
CDS 123..8057
Misc Feature(1)99..101
Misc Feature(2)1404..1406
Misc Feature(3)1404..1406
Misc Feature(4)2517..2627
Misc Feature(5)3477..3794
Misc Feature(6)4107..4217
Misc Feature(7)5433..6398
Misc Feature(8)6087..6089
Misc Feature(9)6999..7823
Misc Feature(10)order(7029..7031,7035..7043,7047..7049,7095..7097,
Misc Feature(11)7092..7823
Misc Feature(12)7536..7562
Misc Feature(13)7602..7670
Misc Feature(14)7956..8054
Exon (1)1..181
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (2)182..273
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (3)274..414
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (4)415..1292
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (5)1293..1471
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (6)1472..1663
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (7)1664..1854
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (8)1855..2007
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (9)2008..2200
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (10)2201..2463
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (11)2464..2654
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (12)2655..2755
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (13)2756..2927
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (14)2928..3098
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (15)3099..3293
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (16)3294..3479
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (17)3480..3572
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (18)3573..3703
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (19)3704..3847
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (20)3848..3941
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (21)3942..4067
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (22)4068..4274
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (23)4275..4388
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (24)4389..4504
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (25)4505..4625
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (26)4626..4763
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (27)4764..4974
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (28)4975..5153
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (29)5154..5318
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (30)5319..5410
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (31)5411..5502
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (32)5503..5680
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (33)5681..5860
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (34)5861..6020
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (35)6021..6200
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (36)6201..6343
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (37)6344..6441
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (38)6442..6674
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (39)6675..6809
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (40)6810..7019
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (41)7020..7163
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (42)7164..7314
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (43)7315..7471
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (44)7472..7625
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (45)7626..7777
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (46)7778..7883
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (47)7884..8251
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Translation MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTD SQPTSVMLLDFIQHIMKSSPLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLH KKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVMSRFLS QLDEHMGYLQSAPLQLMSMQNLEFIEVTLLMVLTRIIAIVFFRRQELLLWQIGCVLLEYG SPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHLVEMDTDQLKLYEEPLSKLIK TLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFVPAG YESALQVRKVYVRNICKALLDVLGIEVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENL SSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYS GLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFY TKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIY SHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWAL QSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDSDIVKKEFASILGQLVCTLHG MFYLTSSLTEPFSEHGHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLLKKKIPSPVKL AFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG FIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKS ASVSGAAYTEIRALVAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVR KQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ LNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL LRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLS SSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV RCLDHACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE LKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK YATDSETVEPIISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD FTFVTGVEDSSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGH QLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYLIT KVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDD QHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSNRNKVDSMVST VDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLY AAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVV KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW SVRLGQLLLSAKKRDITAFYDSLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCEL EHSIKPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMV GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV ELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWEDGHF YLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTK AYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVL MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTD KLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANH ASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY MTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRS TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNET GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGW TPYM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(32)-dbSNP:
complement(32)-g, cdbSNP:189343119
complement(94)-t, cdbSNP:150284877
complement(128)-c, adbSNP:143306360
complement(136)-c, adbSNP:200753177
complement(138)-g, adbSNP:201753798
complement(239)-dbSNP:
complement(239)-t, cdbSNP:56297030
complement(242)-g, adbSNP:202059524
complement(312)-dbSNP:
complement(312)-t, cdbSNP:35306038
complement(317)-g, adbSNP:139304565
complement(363)-g, adbSNP:147353060
complement(382)-c, adbSNP:200407265
complement(390)-t, cdbSNP:28897763
complement(411)-t, adbSNP:138473993
complement(447)-dbSNP:
complement(447)-g, adbSNP:146405935
complement(519)-g, adbSNP:146413649
complement(545)-g, adbSNP:10935466
complement(564)-g, cdbSNP:183663179
complement(579)-g, adbSNP:201181535
complement(605)-t, cdbSNP:182268224
complement(754)-t, cdbSNP:2227928
complement(822)-g, adbSNP:112259166
complement(843)-t, cdbSNP:200418139
complement(872)-g, cdbSNP:148033779
complement(883)-t, cdbSNP:35648400
complement(903)-g, adbSNP:145605847
complement(938)-g, adbSNP:34685245
complement(944)-c, adbSNP:185813423
complement(966)-g, cdbSNP:200664758
complement(992)-g, adbSNP:142365176
complement(1000)-t, cdbSNP:146741961
complement(1013)-g, cdbSNP:2229033
complement(1036)-g, adbSNP:149129526
complement(1068)-g, adbSNP:28897764
complement(1085)-t, cdbSNP:192883042
complement(1114)-t, cdbSNP:150008448
complement(1115)-g, adbSNP:139379319
complement(1116)-t, cdbSNP:147932626
complement(1177)-t, cdbSNP:200283104
complement(1184)-c, adbSNP:144776553
complement(1249)-t, cdbSNP:200947706
complement(1448)-dbSNP:
complement(1448)-g, adbSNP:28897765
complement(1450)-g, cdbSNP:28367453
complement(1481)-dbSNP:
complement(1481)-c, adbSNP:202239914
complement(1571)-c, adbSNP:200968047
complement(1649)-t, adbSNP:141167856
complement(1676)-dbSNP:
complement(1676)-g, cdbSNP:148605594
complement(1704)-t, gdbSNP:200033739
complement(1746)-t, cdbSNP:200491706
complement(1778)-t, cdbSNP:143984042
complement(1789..1790)-, gaadbSNP:10620451
complement(1886)-dbSNP:
complement(1886)-t, cdbSNP:149482096
complement(1898)-t, adbSNP:2227930
complement(1900)-g, adbSNP:145459793
complement(1928)-g, adbSNP:141715084
complement(1937)-t, cdbSNP:2227929
complement(2026)-dbSNP:
complement(2026)-t, cdbSNP:202162034
complement(2072)-g, adbSNP:28910270
complement(2169)-t, cdbSNP:140952649
complement(2200)-g, adbSNP:185048028
complement(2210)-dbSNP:
complement(2210)-g, adbSNP:202050285
complement(2250)-t, cdbSNP:151033656
complement(2279)-g, adbSNP:150161871
complement(2280)-t, cdbSNP:143633875
complement(2327)-g, adbSNP:148955716
complement(2348)-g, adbSNP:147895945
complement(2349)-t, cdbSNP:144835955
complement(2401)-g, adbSNP:140901705
complement(2412)-t, cdbSNP:77208665
complement(2423)-g, adbSNP:150060445
complement(2522)-dbSNP:
complement(2522)-t, gdbSNP:202026376
complement(2541)-t, cdbSNP:200582541
complement(2564)-t, cdbSNP:55895932
complement(2746)-dbSNP:
complement(2746)-t, gdbSNP:200954767
complement(2759)-dbSNP:
complement(2759)-g, adbSNP:150512706
complement(2764)-t, cdbSNP:144163021
complement(2775)-t, cdbSNP:141606250
complement(2793)-g, cdbSNP:139224919
complement(2810)-t, cdbSNP:117926957
complement(2825)-t, gdbSNP:201052932
complement(2826)-g, adbSNP:146202702
complement(2857)-t, cdbSNP:186118386
complement(2898)-g, adbSNP:141783863
complement(2966)-dbSNP:
complement(2966)-t, gdbSNP:147286949
complement(2971)-g, adbSNP:146041880
complement(2973)-t, gdbSNP:200669405
complement(2997)-g, adbSNP:28910271
complement(3017)-g, adbSNP:113982627
complement(3068)-g, adbSNP:138061993
complement(3080)-g, adbSNP:143919996
complement(3150)-dbSNP:
complement(3150)-c, adbSNP:6795497
complement(3200)-t, cdbSNP:201306116
complement(3242)-g, adbSNP:28910272
complement(3305)-dbSNP:
complement(3305)-t, cdbSNP:138025798
complement(3363)-g, adbSNP:139173669
complement(3367)-t, cdbSNP:146504354
complement(3381)-g, adbSNP:34253059
complement(3429)-t, cdbSNP:142583176
complement(3449)-g, adbSNP:147717467
complement(3494)-dbSNP:
complement(3494)-t, cdbSNP:142903351
complement(3546)-t, cdbSNP:149008479
complement(3555)-t, cdbSNP:145853128
complement(3619)-dbSNP:
complement(3619)-t, adbSNP:201438783
complement(3689)-g, adbSNP:149882558
complement(3695)-t, cdbSNP:191631592
complement(3759)-dbSNP:
complement(3759)-t, cdbSNP:34766606
complement(3764)-g, adbSNP:139078985
complement(3817)-t, gdbSNP:201150434
complement(3824)-g, adbSNP:146222193
complement(3905)-dbSNP:
complement(3905)-t, adbSNP:202136214
complement(3928)-t, cdbSNP:200133147
complement(4010)-dbSNP:
complement(4010)-g, adbSNP:143268462
complement(4015)-t, adbSNP:148994209
complement(4087)-dbSNP:
complement(4087)-t, gdbSNP:75450693
complement(4124)-t, cdbSNP:56026468
complement(4184)-g, adbSNP:79938859
complement(4322)-dbSNP:
complement(4322)-t, adbSNP:150562945
complement(4324)-g, adbSNP:199851807
complement(4382)-g, adbSNP:141720641
complement(4436)-dbSNP:
complement(4436)-t, cdbSNP:55806603
complement(4445)-t, cdbSNP:56100509
complement(4473)-g, adbSNP:148064542
complement(4498)-t, cdbSNP:144591613
complement(4527)-dbSNP:
complement(4527)-t, cdbSNP:78895258
complement(4529)-g, adbSNP:201300027
complement(4583)-g, adbSNP:139029532
complement(4603)-c, adbSNP:146636161
complement(4698)-dbSNP:
complement(4698)-t, cdbSNP:34124242
complement(4714)-t, cdbSNP:200070057
complement(4737)-t, cdbSNP:138350940
complement(4771)-dbSNP:
complement(4771)-g, adbSNP:184380561
complement(4799)-g, adbSNP:112726878
complement(4852)-c, adbSNP:140533205
complement(4886)-g, adbSNP:142240637
complement(4914)-t, cdbSNP:187734529
complement(4942)-t, cdbSNP:55724025
complement(4957)-t, cdbSNP:55894265
complement(4968)-c, adbSNP:201492267
complement(4973)-t, cdbSNP:146667892
complement(5014)-dbSNP:
complement(5014)-t, cdbSNP:143114566
complement(5019)-g, adbSNP:4282075
complement(5044)-g, adbSNP:139876782
complement(5048)-t, gdbSNP:143923855
complement(5063)-g, adbSNP:186824993
complement(5066)-g, cdbSNP:200668215
complement(5072)-t, cdbSNP:149940145
complement(5085)-t, cdbSNP:200547342
complement(5130)-g, cdbSNP:139135398
complement(5174)-dbSNP:
complement(5174)-g, adbSNP:150810277
complement(5192)-g, adbSNP:142881746
complement(5267)-t, cdbSNP:140570011
complement(5330)-dbSNP:
complement(5330)-t, cdbSNP:2227931
complement(5379)-t, cdbSNP:143806447
complement(5438)-dbSNP:
complement(5438)-t, cdbSNP:146463402
complement(5508)-dbSNP:
complement(5508)-t, cdbSNP:193124641
complement(5518)-g, adbSNP:148117747
complement(5582)-t, cdbSNP:2227932
complement(5686)-dbSNP:
complement(5686)-t, gdbSNP:149412289
complement(5723)-g, adbSNP:138891875
complement(5761)-g, adbSNP:148475359
complement(5764)-g, adbSNP:145185913
complement(5778)-g, adbSNP:141429029
complement(5838)-, cdbSNP:66783146
complement(5866)-dbSNP:
complement(5866)-t, cdbSNP:201445100
complement(5974)-g, cdbSNP:146627198
complement(5990)-g, adbSNP:112018640
complement(6011)-g, adbSNP:140780391
complement(6036)-dbSNP:
complement(6036)-t, cdbSNP:182535875
complement(6053)-t, cdbSNP:150964938
complement(6109)-g, adbSNP:150339560
complement(6144)-g, adbSNP:148465901
complement(6145)-c, adbSNP:145569221
complement(6194)-, tdbSNP:34576460
complement(6209)-dbSNP:
complement(6209)-g, adbSNP:144362854
complement(6210)-t, cdbSNP:201091477
complement(6212)-t, cdbSNP:201988169
complement(6248)-g, adbSNP:200445478
complement(6327)-t, cdbSNP:140633834
complement(6449)-dbSNP:
complement(6449)-g, adbSNP:147210068
complement(6452)-g, adbSNP:143869958
complement(6459)-t, cdbSNP:191588404
complement(6461)-t, cdbSNP:7635479
complement(6481)-g, cdbSNP:35134774
complement(6516)-t, gdbSNP:28910273
complement(6582)-t, cdbSNP:202193482
complement(6790)-dbSNP:
complement(6790)-g, adbSNP:141464709
complement(6808)-g, adbSNP:112373905
complement(6848)-dbSNP:
complement(6848)-g, adbSNP:56030954
complement(7018)-g, adbSNP:145119827
complement(7041)-dbSNP:
complement(7041)-g, adbSNP:62276424
complement(7042..7043)-, cdbSNP:34308202
complement(7089)-t, gdbSNP:180819393
complement(7097)-t, cdbSNP:188177105
complement(7210)-dbSNP:
complement(7210)-t, cdbSNP:142918229
complement(7396)-dbSNP:
complement(7396)-g, adbSNP:2229032
complement(7422)-g, cdbSNP:33972295
complement(7425)-t, cdbSNP:149045116
complement(7440)-g, adbSNP:113377909
complement(7521)-dbSNP:
complement(7521)-t, cdbSNP:144887641
complement(7533)-g, adbSNP:150286172
complement(7534)-g, adbSNP:200700656
complement(7553)-g, adbSNP:140201292
complement(7663)-dbSNP:
complement(7663)-t, cdbSNP:151162347
complement(7754)-t, adbSNP:144427735
complement(7789)-dbSNP:
complement(7789)-g, cdbSNP:200490116
complement(7939)-dbSNP:
complement(7939)-t, cdbSNP:199948706
complement(7997)-g, adbSNP:1802904
complement(8001)-c, adbSNP:112027460
complement(8021)-t, cdbSNP:147649584
complement(8023)-g, adbSNP:1804758
complement(8119)-c, adbSNP:13062441
complement(8174)-c, adbSNP:13062411
Gene SymbolATR
Gene SynonymFCTCS; FRP1; MEC1; SCKL; SCKL1
Chromosome3
Locus Map3q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001184 Homo sapiens ataxia telangiectasia and Rad3 related (ATR), mRNA. On-demand $3749.00 35
Title Nek1 kinase associates with ATR-ATRIP and primes ATR for efficient .
Author Liu,S., Ho,C.K., Ouyang,J. and Zou,L.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (6), 2175-2180 (2013)
Title Engagement of the ATR-dependent DNA damage response at the human papillomavirus 18 replication centers during the initial amplification .
Author Reinson,T., Toots,M., Kadaja,M., Pipitch,R., Allik,M., Ustav,E. and Ustav,M.
Journal J. Virol. 87 (2), 951-964 (2013)
Title In vitro analysis of the role of replication protein A (RPA) and .
Author Lindsey-Boltz,L.A., Reardon,J.T., Wold,M.S. and Sancar,A.
Journal J. Biol. Chem. 287 (43), 36123-36131 (2012)
Title ATM/ATR checkpoint activation downregulates CDC25C to prevent mitotic entry with uncapped telomeres .
Author Thanasoula,M., Escandell,J.M., Suwaki,N. and Tarsounas,M.
Journal EMBO J. 31 (16), 3398-3410 (2012)
Title Checkpoint kinase ATR phosphorylates Cdt2, a substrate receptor of CRL4 ubiquitin ligase, and promotes the degradation of Cdt1 following UV irradiation .
Author Sakaguchi,H., Takami,T., Yasutani,Y., Maeda,T., Morino,M., Ishii,T., Shiomi,Y. and Nishitani,H.
Journal PLoS ONE 7 (9), E46480 (2012)
Title Protein kinase mutants of human ATR increase sensitivity to UV and ionizing radiation and abrogate cell cycle checkpoint control .
Author Wright,J.A., Keegan,K.S., Herendeen,D.R., Bentley,N.J., Carr,A.M., Hoekstra,M.F. and Concannon,P.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (13), 7445-7450 (1998)
Title Overexpression of a kinase-inactive ATR protein causes sensitivity to DNA-damaging agents and defects in cell cycle checkpoints .
Author Cliby,W.A., Roberts,C.J., Cimprich,K.A., Stringer,C.M., Lamb,J.R., Schreiber,S.L. and Friend,S.H.
Journal EMBO J. 17 (1), 159-169 (1998)
Title The Schizosaccharomyces pombe rad3 checkpoint gene .
Author Bentley,N.J., Holtzman,D.A., Flaggs,G., Keegan,K.S., DeMaggio,A., Ford,J.C., Hoekstra,M. and Carr,A.M.
Journal EMBO J. 15 (23), 6641-6651 (1996)
Title The Atr and Atm protein kinases associate with different sites along meiotically pairing chromosomes .
Author Keegan,K.S., Holtzman,D.A., Plug,A.W., Christenson,E.R., Brainerd,E.E., Flaggs,G., Bentley,N.J., Taylor,E.M., Meyn,M.S., Moss,S.B., Carr,A.M., Ashley,T. and Hoekstra,M.F.
Journal Genes Dev. 10 (19), 2423-2437 (1996)
Title cDNA cloning and gene mapping of a candidate human cell cycle checkpoint protein .
Author Cimprich,K.A., Shin,T.B., Keith,C.T. and Schreiber,S.L.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (7), 2850-2855 (1996)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.