• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATR serine/threonine kinase (ATR), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001184 Homo sapiens ATR serine/threonine kinase (ATR), mRNA. GenEZ ORF Cloning On-demand $3749.00 35

*Business Day

Related Services

RefSeq Version NM_001184.3, 157266316
Length 8258 bp
Structure linear
Update Date 19-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens ATR serine/threonine kinase (ATR), mRNA.
Product serine/threonine-protein kinase ATR
Comment

Summary: The protein encoded by this gene belongs the PI3/PI4-kinase family, and is most closely related to ATM, a protein kinase encoded by the gene mutated in ataxia telangiectasia. This protein and ATM share similarity with Schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This kinase has been shown to phosphorylate checkpoint kinase CHK1, checkpoint proteins RAD17, and RAD9, as well as tumor suppressor protein BRCA1. Mutations of this gene are associated with Seckel syndrome. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq, Jul 2008].

RefSeq NP_001175.2
CDS 123..8057
Misc Feature(1)99..101
Misc Feature(2)1404..1406
Misc Feature(3)1404..1406
Misc Feature(4)2517..2627
Misc Feature(5)3477..3794
Misc Feature(6)4107..4217
Misc Feature(7)5433..6398
Misc Feature(8)6087..6089
Misc Feature(9)<6519..8054
Misc Feature(10)6999..7823
Misc Feature(11)order(7029..7031,7035..7043,7047..7049,7095..7097,
Misc Feature(12)7536..7562
Misc Feature(13)7602..7670
Misc Feature(14)7956..8054
Exon (1)1..181
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (2)182..273
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (3)274..414
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (4)415..1292
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (5)1293..1471
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (6)1472..1663
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (7)1664..1854
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (8)1855..2007
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (9)2008..2200
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (10)2201..2463
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (11)2464..2654
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (12)2655..2755
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (13)2756..2927
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (14)2928..3098
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (15)3099..3293
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (16)3294..3479
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (17)3480..3572
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (18)3573..3703
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (19)3704..3847
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (20)3848..3941
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (21)3942..4067
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (22)4068..4274
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (23)4275..4388
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (24)4389..4504
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (25)4505..4625
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (26)4626..4763
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (27)4764..4974
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (28)4975..5153
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (29)5154..5318
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (30)5319..5410
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (31)5411..5502
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (32)5503..5680
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (33)5681..5860
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (34)5861..6020
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (35)6021..6200
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (36)6201..6343
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (37)6344..6441
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (38)6442..6674
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (39)6675..6809
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (40)6810..7019
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (41)7020..7163
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (42)7164..7314
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (43)7315..7471
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (44)7472..7625
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (45)7626..7777
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (46)7778..7883
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Exon (47)7884..8251
Gene:ATR
Gene Synonym:FCTCS; FRP1; MEC1; SCKL; SCKL1
Translation MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTD SQPTSVMLLDFIQHIMKSSPLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLH KKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVMSRFLS QLDEHMGYLQSAPLQLMSMQNLEFIEVTLLMVLTRIIAIVFFRRQELLLWQIGCVLLEYG SPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHLVEMDTDQLKLYEEPLSKLIK TLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFVPAG YESALQVRKVYVRNICKALLDVLGIEVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENL SSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYS GLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFY TKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIY SHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWAL QSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDSDIVKKEFASILGQLVCTLHG MFYLTSSLTEPFSEHGHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLLKKKIPSPVKL AFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG FIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKS ASVSGAAYTEIRALVAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVR KQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ LNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL LRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLS SSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV RCLDHACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE LKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK YATDSETVEPIISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD FTFVTGVEDSSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGH QLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYLIT KVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDD QHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSNRNKVDSMVST VDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLY AAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVV KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW SVRLGQLLLSAKKRDITAFYDSLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCEL EHSIKPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMV GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV ELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWEDGHF YLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTK AYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVL MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTD KLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANH ASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY MTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRS TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNET GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGW TPYM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(32)-dbSNP:
complement(32)-g, cdbSNP:189343119
complement(85)-g, adbSNP:367635810
complement(94)-t, cdbSNP:150284877
complement(114)-t, adbSNP:370554740
complement(128)-c, adbSNP:143306360
complement(131)-t, cdbSNP:377514660
complement(132)-g, adbSNP:373534503
complement(136)-c, adbSNP:200753177
complement(138)-g, adbSNP:201753798
complement(146)-t, cdbSNP:373166003
complement(239)-dbSNP:
complement(239)-t, cdbSNP:56297030
complement(242)-g, adbSNP:202059524
complement(312)-dbSNP:
complement(312)-t, cdbSNP:35306038
complement(317)-g, adbSNP:139304565
complement(338)-g, cdbSNP:375184068
complement(363)-g, adbSNP:147353060
complement(367)-g, adbSNP:373636603
complement(382)-c, adbSNP:200407265
390+c, tdbSNP:28897763
complement(398)-g, cdbSNP:369461039
complement(411)-t, adbSNP:138473993
complement(436)-dbSNP:
complement(436)-t, gdbSNP:374764228
complement(447)-g, adbSNP:146405935
complement(519)-t, g, adbSNP:146413649
complement(545)-g, adbSNP:10935466
complement(559)-t, gdbSNP:368592452
complement(564)-g, cdbSNP:183663179
complement(569)-t, cdbSNP:374777724
complement(579)-g, adbSNP:201181535
complement(601)-t, cdbSNP:371240700
complement(605)-t, cdbSNP:182268224
complement(670)-t, adbSNP:373859192
complement(689)-t, cdbSNP:370714432
754+c, tdbSNP:2227928
complement(766)-t, cdbSNP:368507270
complement(822)-g, adbSNP:112259166
complement(843)-t, cdbSNP:200418139
complement(866)-t, gdbSNP:368117837
complement(872)-g, cdbSNP:148033779
complement(883)-t, cdbSNP:35648400
complement(903)-g, adbSNP:145605847
938+a, gdbSNP:34685245
complement(944)-c, adbSNP:185813423
complement(960)-g, adbSNP:377699114
complement(966)-g, cdbSNP:200664758
complement(992)-g, adbSNP:142365176
complement(1000)-t, cdbSNP:146741961
1013+c, gdbSNP:2229033
complement(1036)-g, adbSNP:149129526
1068+a, gdbSNP:28897764
complement(1085)-t, cdbSNP:192883042
complement(1114)-t, cdbSNP:150008448
complement(1115)-g, adbSNP:139379319
complement(1116)-t, cdbSNP:147932626
complement(1177)-t, cdbSNP:200283104
complement(1184)-c, adbSNP:144776553
complement(1249)-t, cdbSNP:200947706
complement(1345)-dbSNP:
complement(1345)-c, adbSNP:370058763
complement(1380)-g, cdbSNP:377186178
complement(1383)-t, cdbSNP:372973014
complement(1420)-t, cdbSNP:369434236
complement(1433)-g, adbSNP:375623709
1448+a, gdbSNP:28897765
complement(1450)-g, cdbSNP:28367453
complement(1457)-t, cdbSNP:373034384
complement(1481)-dbSNP:
complement(1481)-c, adbSNP:202239914
complement(1533)-g, cdbSNP:371350410
complement(1554)-t, cdbSNP:371017404
complement(1571)-c, adbSNP:200968047
complement(1665)-dbSNP:
complement(1665)-g, adbSNP:371791554
complement(1676)-g, cdbSNP:148605594
complement(1704)-t, gdbSNP:200033739
complement(1741)-t, cdbSNP:371466221
complement(1745)-t, adbSNP:376322544
complement(1746)-t, cdbSNP:200491706
complement(1778)-t, cdbSNP:143984042
complement(1886)-dbSNP:
complement(1886)-t, cdbSNP:149482096
1898+a, tdbSNP:2227930
complement(1900)-g, adbSNP:145459793
complement(1928)-g, adbSNP:141715084
1937+c, tdbSNP:2227929
complement(1946)-t, gdbSNP:373148702
complement(1964)-g, adbSNP:376207579
complement(1969)-t, cdbSNP:374946388
complement(2000)-g, adbSNP:370033429
complement(2026)-dbSNP:
complement(2026)-t, cdbSNP:202162034
complement(2072)-g, adbSNP:28910270
complement(2094)-g, adbSNP:372411144
complement(2169)-t, cdbSNP:140952649
complement(2200)-g, adbSNP:185048028
complement(2210)-dbSNP:
complement(2210)-g, adbSNP:202050285
complement(2249)-t, adbSNP:376286942
complement(2250)-t, cdbSNP:151033656
complement(2259)-g, cdbSNP:373600572
complement(2279)-g, adbSNP:150161871
complement(2280)-t, cdbSNP:143633875
complement(2281)-g, cdbSNP:369939610
complement(2284)-g, adbSNP:377450037
complement(2302)-g, cdbSNP:372610600
complement(2327)-g, adbSNP:148955716
complement(2348)-g, adbSNP:147895945
complement(2349)-t, cdbSNP:144835955
complement(2365)-g, adbSNP:376540496
complement(2401)-g, adbSNP:140901705
complement(2412)-t, cdbSNP:77208665
complement(2423)-g, adbSNP:150060445
complement(2522)-dbSNP:
complement(2522)-t, gdbSNP:202026376
complement(2541)-t, cdbSNP:200582541
complement(2564)-t, cdbSNP:55895932
complement(2586)-t, cdbSNP:369120067
complement(2625)-g, adbSNP:377134163
complement(2666)-dbSNP:
complement(2666)-t, cdbSNP:375409267
complement(2746)-t, gdbSNP:200954767
complement(2759)-dbSNP:
complement(2759)-g, adbSNP:150512706
complement(2760)-t, cdbSNP:367864862
complement(2764)-t, cdbSNP:144163021
complement(2775)-t, cdbSNP:141606250
complement(2793)-g, cdbSNP:139224919
complement(2810)-t, cdbSNP:117926957
complement(2825)-t, gdbSNP:201052932
complement(2826)-g, adbSNP:146202702
complement(2827)-g, cdbSNP:367926815
complement(2857)-t, cdbSNP:186118386
complement(2898)-g, adbSNP:141783863
complement(2966)-dbSNP:
complement(2966)-t, gdbSNP:147286949
complement(2971)-g, adbSNP:146041880
complement(2973)-t, gdbSNP:200669405
complement(2977)-g, adbSNP:373166002
2997+a, gdbSNP:28910271
complement(3017)-g, adbSNP:113982627
complement(3063)-t, cdbSNP:369913351
complement(3068)-g, adbSNP:138061993
complement(3080)-g, adbSNP:143919996
complement(3101)-dbSNP:
complement(3101)-t, cdbSNP:376960547
complement(3150)-t, gdbSNP:386605139
complement(3150)-c, adbSNP:6795497
complement(3200)-t, cdbSNP:201306116
complement(3242)-g, adbSNP:28910272
complement(3273)-g, adbSNP:367641692
complement(3305)-dbSNP:
complement(3305)-t, cdbSNP:138025798
complement(3363)-g, adbSNP:139173669
complement(3367)-t, cdbSNP:146504354
complement(3381)-g, adbSNP:34253059
complement(3429)-t, cdbSNP:142583176
complement(3441)-g, adbSNP:368676027
complement(3449)-g, adbSNP:147717467
complement(3494)-dbSNP:
complement(3494)-t, cdbSNP:142903351
complement(3546)-t, cdbSNP:149008479
complement(3555)-t, cdbSNP:145853128
complement(3556)-g, adbSNP:377698546
complement(3619)-dbSNP:
complement(3619)-t, adbSNP:201438783
complement(3689)-g, adbSNP:149882558
complement(3695)-t, cdbSNP:191631592
complement(3759)-dbSNP:
complement(3759)-t, cdbSNP:34766606
complement(3764)-g, adbSNP:139078985
complement(3817)-t, gdbSNP:201150434
complement(3824)-g, adbSNP:146222193
complement(3905)-dbSNP:
complement(3905)-t, adbSNP:202136214
complement(3921)-t, cdbSNP:377689383
complement(3928)-t, cdbSNP:200133147
complement(3932)-t, cdbSNP:373345386
complement(4010)-dbSNP:
complement(4010)-g, adbSNP:143268462
complement(4015)-t, adbSNP:148994209
complement(4087)-dbSNP:
complement(4087)-t, gdbSNP:75450693
complement(4124)-t, cdbSNP:56026468
complement(4169)-t, cdbSNP:373570604
complement(4184)-g, adbSNP:79938859
complement(4322)-dbSNP:
complement(4322)-t, adbSNP:150562945
complement(4324)-g, adbSNP:199851807
complement(4357)-t, cdbSNP:371292374
complement(4382)-g, adbSNP:141720641
complement(4403)-dbSNP:
complement(4403)-t, adbSNP:374108762
complement(4436)-t, cdbSNP:55806603
complement(4445)-t, cdbSNP:56100509
complement(4467)-g, adbSNP:376890858
complement(4473)-g, adbSNP:148064542
complement(4474)-t, cdbSNP:371919176
complement(4478)-t, cdbSNP:376297401
complement(4498)-t, cdbSNP:144591613
complement(4527)-dbSNP:
complement(4527)-t, cdbSNP:78895258
complement(4529)-g, adbSNP:201300027
complement(4562)-t, cdbSNP:367920820
complement(4583)-g, adbSNP:139029532
complement(4603)-c, adbSNP:146636161
4631+dbSNP:
4631+a, tdbSNP:398123602
complement(4632)-g, adbSNP:374342162
complement(4698)-t, cdbSNP:34124242
complement(4714)-t, cdbSNP:200070057
complement(4721)-c, adbSNP:373547593
complement(4724)-t, cdbSNP:371438589
complement(4737)-t, cdbSNP:138350940
complement(4771)-dbSNP:
complement(4771)-g, adbSNP:184380561
complement(4799)-g, adbSNP:112726878
complement(4852)-c, adbSNP:140533205
complement(4886)-g, adbSNP:142240637
complement(4911)-g, cdbSNP:373665227
complement(4914)-t, cdbSNP:187734529
complement(4942)-t, cdbSNP:55724025
complement(4957)-t, cdbSNP:55894265
complement(4967)-g, cdbSNP:369712804
complement(4968)-c, adbSNP:201492267
complement(4973)-t, cdbSNP:146667892
complement(5014)-dbSNP:
complement(5014)-t, cdbSNP:143114566
complement(5019)-g, adbSNP:4282075
complement(5044)-g, adbSNP:139876782
complement(5048)-t, gdbSNP:143923855
complement(5063)-g, adbSNP:186824993
complement(5066)-g, cdbSNP:200668215
complement(5072)-t, cdbSNP:149940145
complement(5085)-t, cdbSNP:200547342
complement(5130)-g, cdbSNP:139135398
complement(5155)-dbSNP:
complement(5155)-t, gdbSNP:373855542
complement(5174)-g, adbSNP:150810277
complement(5178)-g, adbSNP:370737602
complement(5192)-g, adbSNP:142881746
complement(5255)-g, adbSNP:368178207
complement(5267)-t, cdbSNP:140570011
complement(5288)-g, adbSNP:368448214
5330+dbSNP:
5330+c, tdbSNP:2227931
complement(5333)-g, adbSNP:370153176
complement(5379)-t, cdbSNP:143806447
complement(5408)-g, cdbSNP:377386677
complement(5424)-dbSNP:
complement(5424)-g, cdbSNP:369378664
complement(5427)-g, cdbSNP:376811787
complement(5438)-t, cdbSNP:146463402
complement(5503)-dbSNP:
complement(5503)-t, cdbSNP:376922396
complement(5508)-t, cdbSNP:193124641
complement(5518)-g, adbSNP:148117747
5582+c, tdbSNP:2227932
complement(5686)-dbSNP:
complement(5686)-t, gdbSNP:149412289
complement(5694)-g, adbSNP:367898142
complement(5723)-g, adbSNP:138891875
5757+g, tdbSNP:387907327
complement(5761)-g, adbSNP:148475359
complement(5764)-g, adbSNP:145185913
complement(5778)-g, adbSNP:141429029
complement(5862)-dbSNP:
complement(5862)-g, adbSNP:368559821
complement(5866)-t, cdbSNP:201445100
complement(5990)-g, adbSNP:112018640
complement(6016)-g, cdbSNP:376314540
complement(6021)-dbSNP:
complement(6021)-t, cdbSNP:371240239
complement(6036)-t, cdbSNP:182535875
complement(6053)-t, cdbSNP:150964938
complement(6109)-g, adbSNP:150339560
complement(6141)-t, cdbSNP:374253623
complement(6144)-g, adbSNP:148465901
complement(6145)-c, adbSNP:145569221
complement(6189)-, tdbSNP:34576460
complement(6209)-dbSNP:
complement(6209)-g, adbSNP:144362854
complement(6210)-t, cdbSNP:201091477
complement(6212)-t, cdbSNP:201988169
complement(6248)-g, adbSNP:200445478
complement(6314)-g, adbSNP:267599632
complement(6318)-g, adbSNP:369309229
complement(6327)-t, cdbSNP:140633834
complement(6348)-dbSNP:
complement(6348)-g, cdbSNP:372864251
complement(6449)-dbSNP:
complement(6449)-g, adbSNP:147210068
complement(6452)-g, adbSNP:143869958
complement(6459)-t, cdbSNP:191588404
complement(6461)-t, cdbSNP:7635479
complement(6481)-g, cdbSNP:35134774
complement(6498)-t, cdbSNP:370244617
6516+g, tdbSNP:28910273
6553+a, gdbSNP:387906797
complement(6554)-t, cdbSNP:376533466
complement(6581)-g, adbSNP:374110291
complement(6582)-t, cdbSNP:202193482
complement(6695)-dbSNP:
complement(6695)-t, cdbSNP:370388187
complement(6790)-g, adbSNP:141464709
complement(6808)-g, adbSNP:112373905
complement(6817)-dbSNP:
complement(6817)-c, adbSNP:370107362
complement(6848)-g, adbSNP:56030954
complement(6939)-t, cdbSNP:374965906
complement(7002)-c, adbSNP:370379866
complement(7018)-g, adbSNP:145119827
complement(7041)-dbSNP:
complement(7041)-g, adbSNP:62276424
complement(7042..7043)-, cdbSNP:34308202
complement(7089)-t, gdbSNP:180819393
complement(7097)-t, cdbSNP:188177105
complement(7210)-dbSNP:
complement(7210)-t, cdbSNP:142918229
complement(7385)-dbSNP:
complement(7385)-g, cdbSNP:377119675
7396+a, gdbSNP:2229032
complement(7396)-g, adbSNP:386561703
7422+c, gdbSNP:33972295
complement(7425)-t, cdbSNP:149045116
complement(7440)-g, adbSNP:113377909
complement(7521)-dbSNP:
complement(7521)-t, cdbSNP:144887641
complement(7533)-g, adbSNP:150286172
complement(7534)-g, adbSNP:200700656
complement(7548)-t, gdbSNP:376735982
complement(7553)-g, adbSNP:140201292
complement(7609)-t, cdbSNP:373093280
complement(7610)-g, adbSNP:369200535
complement(7663)-dbSNP:
complement(7663)-t, cdbSNP:151162347
complement(7681)-g, adbSNP:372898565
complement(7754)-t, adbSNP:144427735
complement(7789)-dbSNP:
complement(7789)-g, cdbSNP:200490116
complement(7939)-dbSNP:
complement(7939)-t, cdbSNP:199948706
complement(7961)-t, cdbSNP:371176601
complement(7979)-g, adbSNP:368061331
complement(7986)-g, adbSNP:374127772
7997+a, gdbSNP:1802904
complement(8001)-c, adbSNP:112027460
complement(8021)-t, cdbSNP:147649584
8023+a, gdbSNP:1804758
complement(8023)-t, cdbSNP:386545678
complement(8064)-t, cdbSNP:373154652
complement(8119)-c, adbSNP:13062441
complement(8174)-c, adbSNP:13062411
Gene SymbolATR
Gene SynonymFCTCS; FRP1; MEC1; SCKL; SCKL1
Chromosome3
Locus Map3q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001184 Homo sapiens ATR serine/threonine kinase (ATR), mRNA. On-demand $3749.00 35
Title ATR checkpoint kinase and CRL1betaTRCP collaborate to degrade ASF1a and thus repress genes overlapping with clusters of stalled replication forks .
Author Im JS, Keaton M, Lee KY, Kumar P, Park J and Dutta A.
Journal Genes Dev. 28 (8), 875-887 (2014)
Title STAT3 interrupts ATR-Chk1 signaling to allow oncovirus-mediated cell proliferation .
Author Koganti S, Hui-Yuen J, McAllister S, Gardner B, Grasser F, Palendira U, Tangye SG, Freeman AF and Bhaduri-McIntosh S.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (13), 4946-4951 (2014)
Title Targeted inhibition of ATR or CHEK1 reverses radioresistance in oral squamous cell carcinoma cells with distal chromosome arm 11q loss .
Author Sankunny M, Parikh RA, Lewis DW, Gooding WE, Saunders WS and Gollin SM.
Journal Genes Chromosomes Cancer 53 (2), 129-143 (2014)
Title ATR prohibits replication catastrophe by preventing global exhaustion of RPA .
Author Toledo LI, Altmeyer M, Rask MB, Lukas C, Larsen DH, Povlsen LK, Bekker-Jensen S, Mailand N, Bartek J and Lukas J.
Journal Cell 155 (5), 1088-1103 (2013)
Title Herpes simplex virus type 1 single strand DNA binding protein and helicase/primase complex disable cellular ATR signaling .
Author Mohni KN, Smith S, Dee AR, Schumacher AJ and Weller SK.
Journal PLoS Pathog. 9 (10), E1003652 (2013)
Title Overexpression of a kinase-inactive ATR protein causes sensitivity to DNA-damaging agents and defects in cell cycle checkpoints .
Author Cliby WA, Roberts CJ, Cimprich KA, Stringer CM, Lamb JR, Schreiber
Journal EMBO J. 17 (1), 159-169 (1998)
Title The Schizosaccharomyces pombe rad3 checkpoint gene .
Author Bentley NJ, Holtzman DA, Flaggs G, Keegan KS, DeMaggio A, Ford JC, Hoekstra M and Carr AM.
Journal EMBO J. 15 (23), 6641-6651 (1996)
Title The Atr and Atm protein kinases associate with different sites along meiotically pairing chromosomes .
Author Keegan KS, Holtzman DA, Plug AW, Christenson ER, Brainerd EE, Flaggs G, Bentley NJ, Taylor EM, Meyn MS, Moss SB, Carr AM, Ashley
Journal Genes Dev. 10 (19), 2423-2437 (1996)
Title cDNA cloning and gene mapping of a candidate human cell cycle checkpoint protein .
Author Cimprich KA, Shin TB, Keith CT and Schreiber SL.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (7), 2850-2855 (1996)
Title Primary Autosomal Recessive Microcephalies and Seckel Syndrome Spectrum Disorders .
Author Verloes,A., Drunat,S., Gressens,P. and Passemard,S.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.