• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001190458 Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_001190458.1, 299473743
Length 7159 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 2, mRNA.
Product dedicator of cytokinesis protein 8 isoform 2
Comment

Summary: This gene encodes a member of the DOCK180 family of guanine nucleotide exchange factors. Guanine nucleotide exchange factors interact with Rho GTPases and are components of intracellular signaling networks. Mutations in this gene result in the autosomal recessive form of the hyper-IgE syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Jun 2010].


Transcript Variant: This variant (2) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at a downstream start codon, compared to variant 1. This variant also lacks an in-frame exon in the middle portion of the coding region, compared to variant 1. The encoded isoform (2) is shorter than isoform 1.

RefSeq NP_001177387.1
CDS 102..6101
Misc Feature(1)15..17
Misc Feature(2)15..17
Misc Feature(3)102..389
Misc Feature(4)102..389
Misc Feature(5)1572..2114
Misc Feature(6)4707..5933
Misc Feature(7)order(5058..5060,5088..5090,5094..5099,5103..5108,
Misc Feature(8)order(5178..5180,5184..5186,5253..5255,5262..5273,
Misc Feature(9)order(5748..5756,5763..5765)
Exon (1)1..53
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (2)54..229
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (3)230..301
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (4)302..425
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (5)426..638
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (6)639..724
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (7)725..791
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (8)792..941
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (9)942..1022
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (10)1023..1182
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (11)1183..1319
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (12)1320..1413
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (13)1414..1576
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (14)1577..1694
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (15)1695..1765
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (16)1766..1904
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (17)1905..2006
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (18)2007..2102
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (19)2103..2337
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (20)2338..2502
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (21)2503..2675
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (22)2676..2771
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (23)2772..2921
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (24)2922..3035
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (25)3036..3191
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (26)3192..3331
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (27)3332..3501
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (28)3502..3641
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (29)3642..3824
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (30)3825..3954
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (31)3955..4042
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (32)4043..4139
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (33)4140..4274
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (34)4275..4427
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (35)4428..4586
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (36)4587..4687
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (37)4688..4880
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (38)4881..5024
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (39)5025..5156
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (40)5157..5291
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (41)5292..5381
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (42)5382..5618
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (43)5619..5762
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (44)5763..5869
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (45)5870..6040
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Exon (46)6041..7141
Gene:DOCK8
Gene Synonym:MRD2; ZIR8
Translation MTHLNSLDVQLAQELGDFTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRDCVQTYIRE WLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPAAQAGPRHLNVLCDV SGKGPVTACDFDLRSLQPDKRLENLLQQVSAEDFEKQNEEARRTNRQAELFALYPSVDEE DAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKISENFHCDLN SDQFKGFLRAHTPSVAASSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGDCAEPYTVI KESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLEREVTDVDSVV GRSSVGERRTLAQSRRLSERALSLEENGVGSNFKTSTLSVSSFFKQEGDRLSDEDLFKFL ADYKRSSSLQRRVKSIPGLLRLEISTAPEIINCCLTPEMLPVKPFPENRTRPHKEILEFP TREVYVPHTVYRNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGP EFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGY SWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQA VSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISEMALEHELKLSIICLNSSRLEPL VLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKDQHGRNCLL ASYVHYVFRLPEVQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKLLQARVMSSSNPDL AGTHSAADEEVKNIMSSKHFHEELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQHVHN MDKRDSFRRTRFSDRFMDDITTIVNVVTSEIAALLVKPQKENEQAEKMNISLAFFLYDLL SLMDRGFVFNLIRHYCSQLSAKLSNLPTLISMRLEFLRILCSHEHYLNLNLFFMNADTAP TSPCPSISSQNSSSCSSFQDQKIASMFDLTSEYRQQHFLTGLLFTELAAALDAEGEGISK VQRKAVSAIHSLLSSHDLDPRCVKPEVKVKIAALYLPLVGIILDALPQLCDFTVADTRRY RTSGSDEEQEGAGAINQNVALAIAGNNFNLKTSGIVLSSLPYKQYNMLNADTTRNLMICF LWIMKNADQSLIRKWIADLPSTQLNRILDLLFICVLCFEYKGKQSSDKVSTQVLQKSRDV KARLEEALLRGEGARGEMMRRRAPGNDRFPGLNENLRWKKEQTHWRQANEKLDKTKAELD QEALISGNLATEAHLIILDMQENIIQASSALDCKDSLLGGVLRVLVNSLNCDQSTTYLTH CFATLRALIAKFGDLLFEEEVEQCFDLCHQVLHHCSSSMDVTRSQACATLYLLMRFSFGA TSNFARVKMQVTMSLASLVGRAPDFNEEHLRRSLRTILAYSEEDTAMQMTPFPTQVEELL CNLNSILYDTVKMREFQEDPEMLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKKKCYTE AAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESVVSEDTLSPDEDGVCAG QYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHREFRKLTLTHSKLQRAFD SIVNKDHKRMFGTYFRVGFFGSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAE FVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFT LEGRPRGELHEQYRRNTVLTTMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLA VAINQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEF IMRCGEAVEKNKRLITADQREYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKR DSFHRSSFRKCETQLSQGS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27+c, tdbSNP:201821657
59+dbSNP:
59+a, gdbSNP:190478517
70+c, gdbSNP:181739250
84+a, gdbSNP:3209441
101+a, gdbSNP:138521760
165+a, gdbSNP:113165814
186+a, cdbSNP:529208
197+c, tdbSNP:147334399
211+c, gdbSNP:201472678
216+c, tdbSNP:199565980
240+dbSNP:
240+c, gdbSNP:140270895
275+c, gdbSNP:141175202
276+c, tdbSNP:185505140
277+a, gdbSNP:150742426
290+c, tdbSNP:139097471
349+dbSNP:
349+a, gdbSNP:149918318
391+c, tdbSNP:146490788
435+dbSNP:
435+c, tdbSNP:141961156
438+c, gdbSNP:200684000
447+a, gdbSNP:143461644
456+a, gdbSNP:111842279
459+a, gdbSNP:201847818
465+a, gdbSNP:146771524
477+a, gdbSNP:141210649
501+c, tdbSNP:143243731
514+c, tdbSNP:71509947
523+a, gdbSNP:151262535
527+a, gdbSNP:140509120
533..535+, cctdbSNP:200991480
533+, cctdbSNP:74411356
537+c, tdbSNP:150446322
550+g, tdbSNP:138464033
553+c, tdbSNP:144019007
558+c, gdbSNP:146903530
560+a, cdbSNP:139391329
576+a, gdbSNP:76276364
582+c, gdbSNP:149234127
596+c, tdbSNP:2039045
606+a, gdbSNP:11789099
642+dbSNP:
642+a, gdbSNP:202110964
689+c, gdbSNP:141674633
724+a, gdbSNP:3209444
736..737+dbSNP:
736..737+, adbSNP:34168163
767+c, gdbSNP:201244929
795+dbSNP:
795+g, tdbSNP:145978391
830+c, gdbSNP:139917518
846+c, tdbSNP:113432057
847+a, gdbSNP:191413750
849+c, tdbSNP:35482838
863+a, gdbSNP:146744703
870+a, gdbSNP:139202607
872+a, gdbSNP:199714207
883+c, tdbSNP:75352090
913+c, tdbSNP:145716710
914+c, tdbSNP:35746964
924+a, gdbSNP:143696910
933+a, gdbSNP:148994877
938+c, g, tdbSNP:143822795
987+dbSNP:
987+c, tdbSNP:146777948
995+a, gdbSNP:139297216
1012+a, gdbSNP:180928267
1064+dbSNP:
1064+a, cdbSNP:141586983
1090+a, gdbSNP:147287319
1119+c, tdbSNP:201968420
1135+a, gdbSNP:10970979
1148+c, tdbSNP:201361966
1253+dbSNP:
1253+a, gdbSNP:113175936
1254+g, tdbSNP:113203757
1268+c, tdbSNP:145968092
1280+a, cdbSNP:78319891
1285+a, cdbSNP:138599749
1315+a, gdbSNP:112321280
1316+a, gdbSNP:141697509
1355..1356+dbSNP:
1355..1356+, cdbSNP:34120681
1456+dbSNP:
1456+a, gdbSNP:190532814
1479+a, cdbSNP:146250176
1484+c, gdbSNP:146289269
1503+a, gdbSNP:142672405
1520+c, gdbSNP:200201944
1553+a, gdbSNP:150595667
1562+c, tdbSNP:139250995
1588+dbSNP:
1588+a, gdbSNP:148440256
1589+c, tdbSNP:10972587
1592+c, gdbSNP:142555294
1607+a, gdbSNP:142434917
1610+c, gdbSNP:200295708
1635+c, tdbSNP:144793271
1636+a, gdbSNP:145805893
1667+c, tdbSNP:148988557
1687+c, tdbSNP:17673268
1697+dbSNP:
1697+c, gdbSNP:148177924
1709+c, tdbSNP:913703
1720+c, gdbSNP:189953367
1778+dbSNP:
1778+c, tdbSNP:140134223
1784+a, gdbSNP:138570904
1794+a, gdbSNP:141657408
1930+dbSNP:
1930+a, gdbSNP:146223665
1937+a, cdbSNP:138021743
1984+a, gdbSNP:149521894
2009+dbSNP:
2009+a, gdbSNP:144130312
2172+dbSNP:
2172+a, gdbSNP:148693111
2184+a, cdbSNP:145324665
2192+c, tdbSNP:12348944
2200+c, tdbSNP:140779178
2207+a, gdbSNP:116175117
2237+c, gdbSNP:10814431
2290+a, gdbSNP:140546511
2307+a, gdbSNP:150038381
2330+c, tdbSNP:145382834
2341+dbSNP:
2341+a, cdbSNP:141451302
2348+c, tdbSNP:144581400
2369+g, tdbSNP:189393588
2379+a, gdbSNP:138519226
2408+a, gdbSNP:140248537
2451+c, gdbSNP:199771908
2505+dbSNP:
2505+a, gdbSNP:143495336
2515+c, tdbSNP:199560543
2551+a, gdbSNP:148017668
2563+c, tdbSNP:186121383
2621+c, tdbSNP:141713879
2636+c, tdbSNP:116523732
2646+a, gdbSNP:200899164
2717+dbSNP:
2717+c, tdbSNP:2297075
2728+c, gdbSNP:140711326
2792+dbSNP:
2792+c, tdbSNP:190559109
2822+c, tdbSNP:7034926
2823+c, tdbSNP:16937932
2824+a, gdbSNP:145844320
2845+a, gdbSNP:200494857
2853+a, gdbSNP:142910397
2859+a, gdbSNP:151094543
2868+a, gdbSNP:140148619
2880+a, gdbSNP:199782622
2914+c, tdbSNP:148929748
2959+dbSNP:
2959+c, tdbSNP:143877293
2994+c, tdbSNP:146891937
3009+a, gdbSNP:73382631
3021+a, cdbSNP:150298985
3031+c, tdbSNP:34627722
3064+dbSNP:
3064+c, tdbSNP:149065013
3101+c, tdbSNP:201371117
3107+c, tdbSNP:143112801
3113+c, gdbSNP:138810908
3114+c, gdbSNP:187779900
3124+a, gdbSNP:151210108
3140+a, tdbSNP:140392509
3160+c, tdbSNP:142839527
3178+c, gdbSNP:147007952
3230+dbSNP:
3230+c, tdbSNP:138210003
3242+a, gdbSNP:34621129
3252+c, tdbSNP:77140987
3261+a, gdbSNP:34390308
3282+a, gdbSNP:139289534
3285..3294+, cdbSNP:113944762
3291..3308+, tggctgctdbSNP:112659914
3308+a, tdbSNP:149585138
3320+c, tdbSNP:144299704
3331+g, tdbSNP:117350404
3366+dbSNP:
3366+a, gdbSNP:77399114
3374+c, tdbSNP:13285348
3394+a, tdbSNP:111715716
3402+c, tdbSNP:146865157
3404+c, gdbSNP:149908718
3407+c, tdbSNP:143919622
3518+dbSNP:
3518+a, tdbSNP:145382748
3555+c, gdbSNP:142495501
3557+c, tdbSNP:150935084
3563+c, tdbSNP:182387813
3593+a, gdbSNP:185243780
3597+a, gdbSNP:140740975
3614+a, gdbSNP:75411647
3627+g, tdbSNP:148796842
3653+dbSNP:
3653+a, gdbSNP:141291637
3668+c, tdbSNP:146984705
3670+c, tdbSNP:138180879
3706+c, gdbSNP:149116813
3788+c, tdbSNP:143204635
3789+c, gdbSNP:148081681
3804+g, tdbSNP:141863163
3807+c, tdbSNP:111531534
3820+a, gdbSNP:116920018
3835+dbSNP:
3835+c, gdbSNP:138869438
3844+a, cdbSNP:199920672
3888+c, tdbSNP:142093178
3908+c, gdbSNP:2297079
3959+dbSNP:
3959+c, tdbSNP:77803650
3960+c, gdbSNP:182516558
4084+dbSNP:
4084+a, gdbSNP:150057289
4142+dbSNP:
4142+a, gdbSNP:144133844
4269+a, gdbSNP:144405517
4272..4273+, adbSNP:34844548
4292+dbSNP:
4292+c, tdbSNP:7854035
4340+a, c, tdbSNP:147785575
4495+dbSNP:
4495+a, tdbSNP:200574056
4505+a, gdbSNP:201433235
4525+a, gdbSNP:141252560
4537+c, gdbSNP:145202369
4575+c, tdbSNP:200152962
4595+dbSNP:
4595+a, gdbSNP:147611560
4615+a, gdbSNP:201519202
4651+a, gdbSNP:140846364
4685+c, tdbSNP:150165600
4705+dbSNP:
4705+a, gdbSNP:200869192
4802+a, gdbSNP:35662752
4811+a, gdbSNP:142208336
4859+c, tdbSNP:190854825
4918+dbSNP:
4918+c, gdbSNP:144987765
4955+c, tdbSNP:140431229
4956+a, gdbSNP:144279637
4958+a, cdbSNP:142055841
4982+c, tdbSNP:146342286
4983+c, tdbSNP:148134127
4988+a, gdbSNP:111535933
5006+c, tdbSNP:150682688
5008+c, tdbSNP:139990627
5009+a, gdbSNP:144172375
5012+c, tdbSNP:34098809
5083+dbSNP:
5083+c, tdbSNP:139494783
5084+a, gdbSNP:145109550
5097+c, tdbSNP:201776049
5122+a, gdbSNP:147601562
5138+c, tdbSNP:149082704
5147+c, tdbSNP:182571862
5234+dbSNP:
5234+a, gdbSNP:1887957
5396+dbSNP:
5396+c, gdbSNP:151208894
5413+a, gdbSNP:140403518
5472+c, tdbSNP:144951842
5510+a, gdbSNP:146782651
5512+a, gdbSNP:140539006
5570+c, tdbSNP:145689180
5582+c, tdbSNP:138225192
5600+c, tdbSNP:149602835
5626+dbSNP:
5626+g, tdbSNP:143353604
5629+c, tdbSNP:148368084
5633+c, tdbSNP:10491684
5693+c, tdbSNP:138617736
5705+a, tdbSNP:182402358
5709+c, gdbSNP:34908836
5730+c, tdbSNP:12238378
5865+dbSNP:
5865+a, gdbSNP:143458628
5921+dbSNP:
5921+a, gdbSNP:150524921
5924+a, gdbSNP:112194403
5939+c, gdbSNP:139515839
5945+c, gdbSNP:189711349
5957+a, gdbSNP:149711079
5985+a, gdbSNP:201733542
5994+a, gdbSNP:200467822
6002+a, gdbSNP:145573166
6008+a, cdbSNP:79568455
6015+a, gdbSNP:148464417
6094+dbSNP:
6094+a, gdbSNP:188639525
6095+c, gdbSNP:192717366
6120+a, gdbSNP:142083508
6213+c, tdbSNP:10974618
6223+c, tdbSNP:114578242
6250+c, tdbSNP:79678033
6296+c, gdbSNP:184727169
6297+g, tdbSNP:113617251
6359+c, tdbSNP:145094924
6618+a, tdbSNP:147721611
6802+c, tdbSNP:3780338
6830+a, tdbSNP:189243739
6844+c, tdbSNP:117155264
6858+g, tdbSNP:116697485
6946+a, gdbSNP:10157
6952+c, gdbSNP:141017864
6956+a, gdbSNP:191179297
6968+c, tdbSNP:12067
6974+a, gdbSNP:7864253
6976+a, cdbSNP:149823673
6998+a, gdbSNP:183559742
7110+a, gdbSNP:145885889
7132+a, gdbSNP:149002313
Gene SymbolDOCK8
Gene SynonymMRD2; ZIR8
Chromosome9
Locus Map9p24.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001190458 Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 2, mRNA. On-demand $2699.00 30
NM_001193536 Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 3, mRNA. On-demand $3749.00 35
NM_203447 Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 1, mRNA. On-demand $3749.00 35
Title Defective actin accumulation impairs human natural killer cell function in patients with dedicator of cytokinesis 8 deficiency .
Author Mizesko,M.C., Banerjee,P.P., Monaco-Shawver,L., Mace,E.M., Bernal,W.E., Sawalle-Belohradsky,J., Belohradsky,B.H., Heinz,V., Freeman,A.F., Sullivan,K.E., Holland,S.M., Torgerson,T.R., Al-Herz,W., Chou,J., Hanson,I.C., Albert,M.H., Geha,R.S., Renner,E.D. and Orange,J.S.
Journal J. Allergy Clin. Immunol. 131 (3), 840-848 (2013)
Title Clinical, immunological and molecular characterization of DOCK8 and DOCK8-like deficient patients: single center experience of twenty-five patients .
Author Alsum,Z., Hawwari,A., Alsmadi,O., Al-Hissi,S., Borrero,E., Abu-Staiteh,A., Khalak,H.G., Wakil,S., Eldali,A.M., Arnaout,R., Al-Ghonaium,A., Al-Muhsen,S., Al-Dhekri,H., Al-Saud,B. and Al-Mousa,H.
Journal J. Clin. Immunol. 33 (1), 55-67 (2013)
Title DOCK8 functions as an adaptor that links TLR-MyD88 signaling to B cell activation .
Author Jabara,H.H., McDonald,D.R., Janssen,E., Massaad,M.J., Ramesh,N., Borzutzky,A., Rauter,I., Benson,H., Schneider,L., Baxi,S., Recher,M., Notarangelo,L.D., Wakim,R., Dbaibo,G., Dasouki,M., Al-Herz,W., Barlan,I., Baris,S., Kutukculer,N., Ochs,H.D., Plebani,A., Kanariou,M., Lefranc,G., Reisli,I., Fitzgerald,K.A., Golenbock,D., Manis,J., Keles,S., Ceja,R., Chatila,T.A. and Geha,R.S.
Journal Nat. Immunol. 13 (6), 612-620 (2012)
Title Clinical, immunologic and genetic profiles of DOCK8-deficient patients in Kuwait .
Author Al-Herz,W., Ragupathy,R., Massaad,M.J., Al-Attiyah,R., Nanda,A., Engelhardt,K.R., Grimbacher,B., Notarangelo,L., Chatila,T. and Geha,R.S.
Journal Clin. Immunol. 143 (3), 266-272 (2012)
Title Pure distal 9p deletion in a female infant with cerebral palsy .
Author Chen,C.P., Lin,S.P., Su,Y.N., Su,J.W., Chern,S.R., Town,D.D. and Wang,W.
Journal Genet. Couns. 23 (2), 215-221 (2012)
Title Novel PNLIPRP3 and DOCK8 gene expression and prognostic implications of DNA loss on chromosome 10q25.3 in hepatocellular carcinoma .
Author Saelee,P., Wongkham,S., Puapairoj,A., Khuntikeo,N., Petmitr,S., Chariyalertsak,S., Sumethchotimaytha,W. and Karalak,A.
Journal Asian Pac. J. Cancer Prev. 10 (3), 501-506 (2009)
Title Dedicator of cytokinesis 8 is disrupted in two patients with mental retardation and developmental disabilities .
Author Griggs,B.L., Ladd,S., Saul,R.A., DuPont,B.R. and Srivastava,A.K.
Journal Genomics 91 (2), 195-202 (2008)
Title Homozygous deletion and reduced expression of the DOCK8 gene in human lung cancer .
Author Takahashi,K., Kohno,T., Ajima,R., Sasaki,H., Minna,J.D., Fujiwara,T., Tanaka,N. and Yokota,J.
Journal Int. J. Oncol. 28 (2), 321-328 (2006)
Title Isolation and characterisation of DOCK8, a member of the DOCK180-related regulators of cell morphology .
Author Ruusala,A. and Aspenstrom,P.
Journal FEBS Lett. 572 (1-3), 159-166 (2004)
Title Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity .
Author Cote,J.F. and Vuori,K.
Journal J. Cell. Sci. 115 (PT 24), 4901-4913 (2002)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.