• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001190458 Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_001190458.1, 299473743
Length 7159 bp
Structure linear
Update Date 27-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 2, mRNA.
Product dedicator of cytokinesis protein 8 isoform 2
Comment

Summary: This gene encodes a member of the DOCK180 family of guanine nucleotide exchange factors. Guanine nucleotide exchange factors interact with Rho GTPases and are components of intracellular signaling networks. Mutations in this gene result in the autosomal recessive form of the hyper-IgE syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Jun 2010].


Transcript Variant: This variant (2) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at a downstream start codon, compared to variant 1. This variant also lacks an in-frame exon in the middle portion of the coding region, compared to variant 1. The encoded isoform (2) is shorter than isoform 1.

RefSeq NP_001177387.1
CDS 102..6101
Misc Feature(1)15..17
Misc Feature(2)15..17
Misc Feature(3)102..389
Misc Feature(4)102..389
Misc Feature(5)1572..2114
Misc Feature(6)4707..5972
Misc Feature(7)order(5058..5060,5088..5090,5094..5099,5103..5108,
Misc Feature(8)order(5178..5180,5184..5186,5253..5255,5262..5273,
Misc Feature(9)5748..5765
Exon (1)1..53
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (2)54..229
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (3)230..301
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (4)302..425
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (5)426..638
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (6)639..724
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (7)725..791
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (8)792..941
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (9)942..1022
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (10)1023..1182
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (11)1183..1319
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (12)1320..1413
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (13)1414..1576
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (14)1577..1694
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (15)1695..1765
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (16)1766..1904
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (17)1905..2006
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (18)2007..2102
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (19)2103..2337
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (20)2338..2502
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (21)2503..2675
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (22)2676..2771
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (23)2772..2921
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (24)2922..3035
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (25)3036..3191
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (26)3192..3331
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (27)3332..3501
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (28)3502..3641
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (29)3642..3824
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (30)3825..3954
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (31)3955..4042
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (32)4043..4139
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (33)4140..4274
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (34)4275..4427
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (35)4428..4586
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (36)4587..4687
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (37)4688..4880
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (38)4881..5024
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (39)5025..5156
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (40)5157..5291
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (41)5292..5381
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (42)5382..5618
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (43)5619..5762
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (44)5763..5869
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (45)5870..6040
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Exon (46)6041..7141
Gene:DOCK8
Gene Synonym:HEL-205; MRD2; ZIR8
Translation MTHLNSLDVQLAQELGDFTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRDCVQTYIRE WLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPAAQAGPRHLNVLCDV SGKGPVTACDFDLRSLQPDKRLENLLQQVSAEDFEKQNEEARRTNRQAELFALYPSVDEE DAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKISENFHCDLN SDQFKGFLRAHTPSVAASSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGDCAEPYTVI KESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLEREVTDVDSVV GRSSVGERRTLAQSRRLSERALSLEENGVGSNFKTSTLSVSSFFKQEGDRLSDEDLFKFL ADYKRSSSLQRRVKSIPGLLRLEISTAPEIINCCLTPEMLPVKPFPENRTRPHKEILEFP TREVYVPHTVYRNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGP EFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGY SWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQA VSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISEMALEHELKLSIICLNSSRLEPL VLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKDQHGRNCLL ASYVHYVFRLPEVQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKLLQARVMSSSNPDL AGTHSAADEEVKNIMSSKHFHEELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQHVHN MDKRDSFRRTRFSDRFMDDITTIVNVVTSEIAALLVKPQKENEQAEKMNISLAFFLYDLL SLMDRGFVFNLIRHYCSQLSAKLSNLPTLISMRLEFLRILCSHEHYLNLNLFFMNADTAP TSPCPSISSQNSSSCSSFQDQKIASMFDLTSEYRQQHFLTGLLFTELAAALDAEGEGISK VQRKAVSAIHSLLSSHDLDPRCVKPEVKVKIAALYLPLVGIILDALPQLCDFTVADTRRY RTSGSDEEQEGAGAINQNVALAIAGNNFNLKTSGIVLSSLPYKQYNMLNADTTRNLMICF LWIMKNADQSLIRKWIADLPSTQLNRILDLLFICVLCFEYKGKQSSDKVSTQVLQKSRDV KARLEEALLRGEGARGEMMRRRAPGNDRFPGLNENLRWKKEQTHWRQANEKLDKTKAELD QEALISGNLATEAHLIILDMQENIIQASSALDCKDSLLGGVLRVLVNSLNCDQSTTYLTH CFATLRALIAKFGDLLFEEEVEQCFDLCHQVLHHCSSSMDVTRSQACATLYLLMRFSFGA TSNFARVKMQVTMSLASLVGRAPDFNEEHLRRSLRTILAYSEEDTAMQMTPFPTQVEELL CNLNSILYDTVKMREFQEDPEMLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKKKCYTE AAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESVVSEDTLSPDEDGVCAG QYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHREFRKLTLTHSKLQRAFD SIVNKDHKRMFGTYFRVGFFGSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAE FVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFT LEGRPRGELHEQYRRNTVLTTMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLA VAINQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEF IMRCGEAVEKNKRLITADQREYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKR DSFHRSSFRKCETQLSQGS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27+c, tdbSNP:201821657
59+dbSNP:
59+a, gdbSNP:190478517
62+c, tdbSNP:371059454
64+a, gdbSNP:373301364
70+a, c, gdbSNP:181739250
77+g, tdbSNP:370107163
84+a, gdbSNP:3209441
101+a, gdbSNP:138521760
120+c, gdbSNP:368133450
146+c, tdbSNP:370609644
165+a, gdbSNP:113165814
174+g, tdbSNP:375686155
185+a, gdbSNP:368156958
186+a, cdbSNP:529208
197+c, tdbSNP:147334399
202+c, gdbSNP:375895643
211+c, gdbSNP:201472678
216+c, tdbSNP:199565980
220+c, tdbSNP:375758495
240+dbSNP:
240+c, gdbSNP:140270895
275+c, gdbSNP:141175202
276+c, tdbSNP:185505140
277+a, gdbSNP:150742426
290+c, tdbSNP:139097471
291+a, gdbSNP:375178634
297+c, tdbSNP:369513990
312+dbSNP:
312+a, cdbSNP:377658939
349+a, gdbSNP:149918318
368+a, gdbSNP:370904615
374+a, gdbSNP:375091035
382+c, tdbSNP:368835870
391+c, tdbSNP:146490788
435+dbSNP:
435+c, tdbSNP:141961156
436+a, gdbSNP:369412510
438+c, gdbSNP:200684000
447+a, gdbSNP:143461644
456+a, gdbSNP:111842279
459+a, gdbSNP:201847818
463+c, tdbSNP:369919982
465+a, gdbSNP:146771524
477+a, gdbSNP:141210649
501+c, tdbSNP:143243731
502+a, gdbSNP:374288188
514+c, tdbSNP:71509947
520+a, gdbSNP:377430634
523+a, gdbSNP:151262535
527+a, gdbSNP:140509120
533..535+, cctdbSNP:74411356
537+c, tdbSNP:150446322
550+g, tdbSNP:138464033
553+c, tdbSNP:144019007
554+c, tdbSNP:368709669
555+a, gdbSNP:373168547
558+c, gdbSNP:146903530
560+a, cdbSNP:139391329
576+a, gdbSNP:76276364
582+c, gdbSNP:149234127
596+c, tdbSNP:2039045
605+c, tdbSNP:370735655
606+a, gdbSNP:11789099
642+dbSNP:
642+a, gdbSNP:202110964
689+c, gdbSNP:141674633
724+a, gdbSNP:3209444
738..739+dbSNP:
738..739+, adbSNP:34168163
767+c, gdbSNP:201244929
770+c, tdbSNP:369844425
795+dbSNP:
795+g, tdbSNP:145978391
830+c, gdbSNP:139917518
838+g, tdbSNP:372437204
846+c, tdbSNP:113432057
847+a, gdbSNP:191413750
849+c, tdbSNP:35482838
850+c, gdbSNP:376791111
863+a, gdbSNP:146744703
872+a, gdbSNP:199714207
883+c, tdbSNP:75352090
886+c, gdbSNP:373090896
913+c, tdbSNP:145716710
914+c, tdbSNP:35746964
924+a, gdbSNP:143696910
933+a, gdbSNP:148994877
938+c, g, tdbSNP:143822795
987+dbSNP:
987+c, tdbSNP:146777948
994+c, tdbSNP:367543787
995+a, gdbSNP:139297216
1012+a, gdbSNP:180928267
1016+c, tdbSNP:370564355
1038+dbSNP:
1038+c, gdbSNP:368637845
1064+a, cdbSNP:141586983
1071+c, tdbSNP:372598000
1075+a, gdbSNP:374952856
1089+c, tdbSNP:369052464
1090+a, gdbSNP:147287319
1090+a, gdbSNP:386471048
1103+c, tdbSNP:372916172
1119+c, tdbSNP:201968420
1134+a, gdbSNP:376254524
1135+a, gdbSNP:10970979
1135+c, tdbSNP:386516143
1148+c, tdbSNP:201361966
1204+dbSNP:
1204+a, gdbSNP:373630575
1240+a, gdbSNP:368164879
1253+a, gdbSNP:113175936
1254+g, tdbSNP:113203757
1268+c, tdbSNP:145968092
complement(1280)-c, adbSNP:78319891
1285+a, cdbSNP:138599749
1303+a, gdbSNP:376713152
1315+a, gdbSNP:112321280
1316+a, gdbSNP:141697509
1338+dbSNP:
1338+a, gdbSNP:374938180
1355..1356+, cdbSNP:34120681
1373+a, gdbSNP:369359671
1456+dbSNP:
1456+a, gdbSNP:190532814
1458+a, tdbSNP:373094965
1469+g, tdbSNP:377541012
1478+a, gdbSNP:369887523
1479+a, cdbSNP:146250176
1484+c, gdbSNP:146289269
1484+c, gdbSNP:386471254
1485+a, gdbSNP:373187839
1503+a, gdbSNP:142672405
1516+c, tdbSNP:377334031
1520+c, gdbSNP:200201944
1553+a, gdbSNP:150595667
1562+c, tdbSNP:139250995
1580+dbSNP:
1580+a, cdbSNP:372278912
1586+c, gdbSNP:374343164
1588+a, gdbSNP:148440256
1589+a, gdbSNP:386516147
1589+c, tdbSNP:10972587
1592+c, gdbSNP:142555294
1607+a, gdbSNP:142434917
1610+c, gdbSNP:200295708
1623+c, tdbSNP:371852141
1635+c, tdbSNP:144793271
1636+a, gdbSNP:145805893
1667+c, tdbSNP:148988557
1684+a, gdbSNP:367602254
1687+c, tdbSNP:17673268
1693+c, tdbSNP:371700985
1697+dbSNP:
1697+c, gdbSNP:148177924
complement(1709)-t, cdbSNP:913703
1711+c, tdbSNP:377421571
1716+a, gdbSNP:368725266
1720+c, gdbSNP:189953367
1728+c, gdbSNP:373128465
1736+a, gdbSNP:377593459
1778+dbSNP:
1778+c, tdbSNP:140134223
1794+a, gdbSNP:141657408
1797+a, cdbSNP:370257544
1892+c, gdbSNP:373707641
1914+dbSNP:
1914+a, tdbSNP:372858877
1930+a, gdbSNP:146223665
1937+a, cdbSNP:138021743
1984+a, gdbSNP:149521894
1991+c, gdbSNP:369860370
2009+dbSNP:
2009+a, gdbSNP:144130312
2030+c, tdbSNP:377377061
2165+dbSNP:
2165+c, gdbSNP:376532348
2172+a, gdbSNP:148693111
2184+a, cdbSNP:145324665
2192+a, gdbSNP:386523895
2192+c, tdbSNP:12348944
2193+a, gdbSNP:267602235
2200+c, tdbSNP:140779178
2207+a, gdbSNP:116175117
2237+c, gdbSNP:10814431
2248+g, tdbSNP:376140410
2280+c, gdbSNP:369449324
2290+a, gdbSNP:140546511
2303+c, gdbSNP:373893174
2307+a, gdbSNP:150038381
2330+c, tdbSNP:145382834
2341+dbSNP:
2341+a, cdbSNP:141451302
2348+c, tdbSNP:144581400
2361+a, gdbSNP:372503899
2369+g, tdbSNP:189393588
2379+a, gdbSNP:138519226
2403+c, gdbSNP:377055970
2408+a, gdbSNP:140248537
2450+c, tdbSNP:372565541
2451+c, gdbSNP:199771908
2459+c, tdbSNP:376592918
2460+a, gdbSNP:368921839
2491+c, tdbSNP:373018701
2505+dbSNP:
2505+a, gdbSNP:143495336
2514+c, gdbSNP:376607682
2515+c, tdbSNP:199560543
2531+a, gdbSNP:370632366
2543+a, gdbSNP:373515697
2563+c, tdbSNP:186121383
2592+c, tdbSNP:371022243
2621+c, tdbSNP:141713879
2636+c, tdbSNP:116523732
2637+a, gdbSNP:375665207
2642+a, gdbSNP:368171577
2646+a, gdbSNP:200899164
2654+a, gdbSNP:374695584
2717+dbSNP:
2717+c, tdbSNP:2297075
2728+c, gdbSNP:140711326
2772+dbSNP:
2772+c, gdbSNP:371693235
2792+c, tdbSNP:190559109
2802+a, gdbSNP:375008655
2811+c, tdbSNP:369178263
2815+a, tdbSNP:372112449
2822+a, gdbSNP:386606807
2822+c, tdbSNP:7034926
2823+c, tdbSNP:16937932
2824+a, gdbSNP:145844320
2830+c, tdbSNP:370649019
2844+c, tdbSNP:369901029
2845+a, gdbSNP:200494857
2853+a, gdbSNP:142910397
2859+a, gdbSNP:151094543
2868+a, gdbSNP:140148619
2880+a, gdbSNP:199782622
2914+c, tdbSNP:148929748
2924+dbSNP:
2924+a, cdbSNP:377274335
2959+c, tdbSNP:143877293
2981+c, gdbSNP:371145573
2994+c, tdbSNP:146891937
2995+a, gdbSNP:369239221
3009+a, gdbSNP:73382631
3010+a, gdbSNP:368569393
3017+c, gdbSNP:370250940
3021+a, cdbSNP:150298985
3031+c, tdbSNP:34627722
3050+dbSNP:
3050+c, tdbSNP:372358415
3064+c, tdbSNP:149065013
3071+c, tdbSNP:377297446
3079+a, gdbSNP:369894503
3101+c, tdbSNP:201371117
3107+c, tdbSNP:143112801
3113+c, gdbSNP:138810908
3114+c, gdbSNP:187779900
complement(3124)-g, adbSNP:151210108
3140+a, tdbSNP:140392509
3160+c, tdbSNP:142839527
3162+a, gdbSNP:373466608
3178+c, gdbSNP:147007952
3182+a, gdbSNP:369322460
3230+dbSNP:
3230+c, tdbSNP:138210003
3237+a, tdbSNP:371014988
3242+a, gdbSNP:34621129
3252+c, tdbSNP:77140987
3254+c, tdbSNP:373733736
3261+a, gdbSNP:34390308
3282+a, gdbSNP:139289534
3295+, cdbSNP:113944762
3308..3309+, tggctgctdbSNP:112659914
3308+a, tdbSNP:149585138
3312+c, gdbSNP:367567088
3320+c, tdbSNP:144299704
3331+g, tdbSNP:117350404
3366+dbSNP:
3366+a, gdbSNP:77399114
3374+c, tdbSNP:13285348
3394+a, tdbSNP:111715716
3402+c, tdbSNP:146865157
3404+c, gdbSNP:149908718
3407+c, tdbSNP:143919622
3410+c, gdbSNP:368545655
3434+c, tdbSNP:372601035
3518+dbSNP:
3518+a, tdbSNP:145382748
3535+c, tdbSNP:373318465
3555+c, gdbSNP:142495501
3557+c, tdbSNP:150935084
3563+c, tdbSNP:182387813
3582+c, gdbSNP:369694167
3586+c, tdbSNP:376233983
3588+a, gdbSNP:370490613
3593+a, gdbSNP:185243780
3597+a, gdbSNP:140740975
3614+a, gdbSNP:75411647
3627+g, tdbSNP:148796842
3653+dbSNP:
3653+a, gdbSNP:141291637
3668+c, tdbSNP:146984705
3670+c, tdbSNP:138180879
3706+c, gdbSNP:149116813
3711+a, gdbSNP:376247401
3788+c, tdbSNP:143204635
3789+c, gdbSNP:148081681
3804+g, tdbSNP:141863163
3807+c, tdbSNP:111531534
3818+a, gdbSNP:368608032
3820+a, gdbSNP:116920018
3835+dbSNP:
3835+c, gdbSNP:138869438
3844+a, cdbSNP:199920672
3888+c, tdbSNP:142093178
3893+a, gdbSNP:374013508
3908+c, gdbSNP:2297079
3959+dbSNP:
3959+c, tdbSNP:77803650
3960+c, gdbSNP:182516558
4084+dbSNP:
4084+a, gdbSNP:150057289
4142+dbSNP:
4142+a, gdbSNP:144133844
4147+c, tdbSNP:370123223
4252+c, tdbSNP:373337056
4268+a, cdbSNP:375909670
4269+a, gdbSNP:144405517
4273..4274+, adbSNP:34844548
4292+dbSNP:
4292+c, tdbSNP:7854035
4322+a, gdbSNP:371541803
4340+a, c, tdbSNP:147785575
4364+c, tdbSNP:370171781
4422+a, gdbSNP:377296155
4495+dbSNP:
4495+a, tdbSNP:200574056
4505+a, gdbSNP:201433235
4525+a, gdbSNP:141252560
4537+c, gdbSNP:145202369
4564+a, gdbSNP:370245413
4575+c, tdbSNP:200152962
4591+dbSNP:
4591+a, tdbSNP:373454848
4595+a, gdbSNP:147611560
4615+a, gdbSNP:201519202
4651+a, gdbSNP:140846364
4685+c, tdbSNP:150165600
4705+dbSNP:
4705+a, gdbSNP:200869192
4777+c, tdbSNP:376049301
4799+c, gdbSNP:370901183
4800+c, tdbSNP:373762198
4802+a, gdbSNP:35662752
4811+a, gdbSNP:142208336
4859+c, tdbSNP:190854825
4894+dbSNP:
4894+a, gdbSNP:368538451
4918+c, gdbSNP:144987765
4928+c, tdbSNP:372590839
4955+c, tdbSNP:140431229
4956+a, gdbSNP:144279637
4982+c, tdbSNP:146342286
4983+c, tdbSNP:148134127
4985+c, gdbSNP:371723484
4988+a, gdbSNP:111535933
5006+c, tdbSNP:150682688
5008+c, tdbSNP:139990627
5009+a, gdbSNP:144172375
5012+c, tdbSNP:34098809
5067+dbSNP:
5067+a, cdbSNP:373154957
5083+c, tdbSNP:139494783
5084+a, gdbSNP:145109550
5097+c, tdbSNP:201776049
5109+c, gdbSNP:369902285
5122+a, gdbSNP:147601562
5138+c, tdbSNP:149082704
5147+c, tdbSNP:182571862
5234+dbSNP:
5234+a, gdbSNP:1887957
5349+dbSNP:
5349+c, tdbSNP:369327204
5396+dbSNP:
5396+c, gdbSNP:151208894
5403+c, gdbSNP:375218876
5413+a, gdbSNP:140403518
5430+a, gdbSNP:369626419
5436+c, g, tdbSNP:375488228
5446+a, cdbSNP:376529318
5472+c, tdbSNP:144951842
5473+a, gdbSNP:368477654
5482+c, tdbSNP:370087380
5507+a, gdbSNP:372620447
5510+a, gdbSNP:146782651
5512+a, gdbSNP:140539006
5570+c, tdbSNP:145689180
5576+c, gdbSNP:376877796
5582+c, tdbSNP:138225192
5600+c, tdbSNP:149602835
5604+a, cdbSNP:370547715
5629+dbSNP:
5629+c, tdbSNP:148368084
complement(5633)-t, cdbSNP:10491684
5693+c, tdbSNP:138617736
5705+a, tdbSNP:182402358
5709+c, gdbSNP:34908836
5730+c, tdbSNP:12238378
5784+dbSNP:
5784+a, gdbSNP:375023413
5821+a, gdbSNP:368000910
5865+a, gdbSNP:143458628
5888+dbSNP:
5888+c, gdbSNP:371596862
5921+a, gdbSNP:150524921
5924+a, gdbSNP:112194403
5939+c, gdbSNP:139515839
5945+c, gdbSNP:189711349
5956+a, cdbSNP:369700698
5957+a, gdbSNP:149711079
5985+a, gdbSNP:201733542
5994+a, gdbSNP:200467822
6002+a, gdbSNP:145573166
6008+a, cdbSNP:79568455
6015+a, gdbSNP:148464417
6022+c, gdbSNP:375011475
6094+dbSNP:
6094+a, gdbSNP:188639525
6095+c, gdbSNP:192717366
6120+a, gdbSNP:142083508
6151+c, gdbSNP:377597644
6213+c, tdbSNP:10974618
6213+c, tdbSNP:386500839
6223+c, tdbSNP:114578242
6250+c, tdbSNP:79678033
6296+c, gdbSNP:184727169
6297+g, tdbSNP:113617251
6359+c, tdbSNP:145094924
6564+a, gdbSNP:374657685
6618+a, tdbSNP:147721611
complement(6802)-t, cdbSNP:3780338
6830+a, tdbSNP:189243739
6844+c, tdbSNP:117155264
6858+g, tdbSNP:116697485
complement(6946)-g, adbSNP:10157
6952+c, gdbSNP:141017864
6956+a, gdbSNP:191179297
6968+c, tdbSNP:12067
6971+g, tdbSNP:369021850
6974+a, gdbSNP:7864253
complement(6976)-c, adbSNP:149823673
6998+a, gdbSNP:183559742
7110+a, gdbSNP:145885889
7132+a, gdbSNP:149002313
Gene SymbolDOCK8
Gene SynonymHEL-205; MRD2; ZIR8
Chromosome9
Locus Map9p24.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001190458 Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 2, mRNA. On-demand $2699.00 30
NM_001193536 Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 3, mRNA. On-demand $3749.00 35
NM_203447 Homo sapiens dedicator of cytokinesis 8 (DOCK8), transcript variant 1, mRNA. On-demand $3749.00 35
Title Aberrant humoral immune reactivity in DOCK8 deficiency with follicular hyperplasia and nodal plasmacytosis .
Author aan de Kerk DJ, van Leeuwen EM, Jansen MH, van den Berg JM, Alders M, Vermont CL, van Lier RA, Pals ST and Kuijpers TW.
Journal Clin. Immunol. 149 (1), 25-31 (2013)
Title Novel dedicator of cytokinesis 8 mutations identified by multiplex ligation-dependent probe amplification .
Author Toth B, Pistar Z, Csorba G, Balogh I, Kovacs T, Erdos M and Marodi L.
Journal Eur. J. Haematol. 91 (4), 369-375 (2013)
Title DOCK8 is critical for the survival and function of NKT cells .
Author Crawford G, Enders A, Gileadi U, Stankovic S, Zhang Q, Lambe T, Crockford TL, Lockstone HE, Freeman A, Arkwright PD, Smart JM, Ma CS, Tangye SG, Goodnow CC, Cerundolo V, Godfrey DI, Su HC, Randall
Journal Blood 122 (12), 2052-2061 (2013)
Title Immune regulatory functions of DOCK family proteins in health and disease .
Author Nishikimi A, Kukimoto-Niino M, Yokoyama S and Fukui Y.
Journal Exp. Cell Res. 319 (15), 2343-2349 (2013)
Title Dedicator of cytokinesis 8 interacts with talin and Wiskott-Aldrich syndrome protein to regulate NK cell cytotoxicity .
Author Ham H, Guerrier S, Kim J, Schoon RA, Anderson EL, Hamann MJ, Lou Z and Billadeau DD.
Journal J. Immunol. 190 (7), 3661-3669 (2013)
Title Novel PNLIPRP3 and DOCK8 gene expression and prognostic implications of DNA loss on chromosome 10q25.3 in hepatocellular carcinoma .
Author Saelee P, Wongkham S, Puapairoj A, Khuntikeo N, Petmitr S, Chariyalertsak S, Sumethchotimaytha W and Karalak A.
Journal Asian Pac. J. Cancer Prev. 10 (3), 501-506 (2009)
Title Dedicator of cytokinesis 8 is disrupted in two patients with mental retardation and developmental disabilities .
Author Griggs BL, Ladd S, Saul RA, DuPont BR and Srivastava AK.
Journal Genomics 91 (2), 195-202 (2008)
Title Homozygous deletion and reduced expression of the DOCK8 gene in human lung cancer .
Author Takahashi K, Kohno T, Ajima R, Sasaki H, Minna JD, Fujiwara T, Tanaka N and Yokota J.
Journal Int. J. Oncol. 28 (2), 321-328 (2006)
Title Isolation and characterisation of DOCK8, a member of the DOCK180-related regulators of cell morphology .
Author Ruusala A and Aspenstrom P.
Journal FEBS Lett. 572 (1-3), 159-166 (2004)
Title Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity .
Author Cote JF and Vuori K.
Journal J. Cell. Sci. 115 (PT 24), 4901-4913 (2002)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.