• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17157 Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu17157C Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001192.2, 23238191
Length 555 bp
Structure linear
Update Date 26-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA.
Product tumor necrosis factor receptor superfamily member 17
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. [provided by RefSeq, Jul 2008].

RefSeq NP_001183.2
CDS 219..773
Misc Feature(1)192..194
Misc Feature(2)225..230
Misc Feature(3)225..230
Misc Feature(4)237..341
Misc Feature(5)240..356
Misc Feature(6)381..449
Exon (1)1..348
Gene:TNFRSF17
Gene Synonym:BCM; BCMA; CD269; TNFRSF13A
Exon (2)349..495
Gene:TNFRSF17
Gene Synonym:BCM; BCMA; CD269; TNFRSF13A
Exon (3)496..994
Gene:TNFRSF17
Gene Synonym:BCM; BCMA; CD269; TNFRSF13A
Translation MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS ISAR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
62+dbSNP:
62+c, tdbSNP:192605606
69+a, gdbSNP:3743591
75+c, tdbSNP:11570139
159+g, tdbSNP:151308896
214+c, tdbSNP:372620061
251+c, tdbSNP:138231933
273+a, cdbSNP:375886084
275+g, tdbSNP:369340296
276+a, gdbSNP:143690193
297+c, tdbSNP:185085849
298+a, gdbSNP:200779776
306+g, tdbSNP:190015454
313..315+, ctcdbSNP:374554971
315+c, tdbSNP:118120349
369+dbSNP:
369+c, gdbSNP:371280917
373+c, tdbSNP:140266790
379+c, tdbSNP:11570146
380+a, gdbSNP:200361156
394+a, g, tdbSNP:150754620
403+g, tdbSNP:374829740
411+a, gdbSNP:11570147
412+c, tdbSNP:368025520
432+g, tdbSNP:146604927
441+c, g, tdbSNP:11570148
complement(460)-t, cdbSNP:373496
474+a, gdbSNP:17854965
478+a, gdbSNP:375303867
479+c, tdbSNP:180992520
494+a, gdbSNP:373213400
495+a, gdbSNP:376683900
519+a, tdbSNP:371088184
523+c, tdbSNP:143855487
527+c, tdbSNP:201708971
581+c, gdbSNP:146794298
583+c, tdbSNP:140545031
584+a, gdbSNP:183187632
625+c, tdbSNP:374377405
630+a, gdbSNP:199855585
631+c, tdbSNP:113898999
complement(651)-g, adbSNP:35682514
664+g, tdbSNP:151074854
674+a, gdbSNP:35434482
675+a, gdbSNP:150352299
complement(695)-t, cdbSNP:2017662
708+g, tdbSNP:200613750
712+c, gdbSNP:11570159
742+c, tdbSNP:371163866
complement(743)-t, cdbSNP:2071336
746+c, gdbSNP:34546237
752+a, gdbSNP:199882446
772+a, tdbSNP:201838370
785+a, gdbSNP:374545778
790+a, gdbSNP:376885863
795+a, gdbSNP:367581624
867+c, tdbSNP:113128674
889+c, gdbSNP:74008646
978..979+, gtdbSNP:201064111
979..981+ctc, gtctdbSNP:71389075
979+c, gdbSNP:1126889
981..982+, tdbSNP:113542863
981+a, gdbSNP:201687396
989..990+, c, tdbSNP:34223679
Gene SymbolTNFRSF17
Gene SynonymBCM; BCMA; CD269; TNFRSF13A
Chromosome16
Locus Map16p13.1
Title Immunogenicity of dendritic cells pulsed with MAGE3, Survivin and B-cell maturation antigen mRNA for vaccination of multiple myeloma patients .
Author Hobo W, Strobbe L, Maas F, Fredrix H, Greupink-Draaisma A, Esendam B, de Witte T, Preijers F, Levenga H, van Rees B, Raymakers R, Schaap N and Dolstra H.
Journal Cancer Immunol. Immunother. 62 (8), 1381-1392 (2013)
Title B-cell maturation antigen is modified by a single N-glycan chain that modulates ligand binding and surface retention .
Author Huang HW, Chen CH, Lin CH, Wong CH and Lin KI.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (27), 10928-10933 (2013)
Title B-cell maturation antigen is a promising target for adoptive T-cell therapy of multiple myeloma .
Author Carpenter RO, Evbuomwan MO, Pittaluga S, Rose JJ, Raffeld M, Yang S, Gress RE, Hakim FT and Kochenderfer JN.
Journal Clin. Cancer Res. 19 (8), 2048-2060 (2013)
Title B-cell maturation antigen, a proliferation-inducing ligand, and B-cell activating factor are candidate mediators of spinal cord injury-induced autoimmunity .
Author Saltzman JW, Battaglino RA, Salles L, Jha P, Sudhakar S, Garshick E, Stott HL, Zafonte R and Morse LR.
Journal J. Neurotrauma 30 (6), 434-440 (2013)
Title APRIL binding to BCMA activates a JNK2-FOXO3-GADD45 pathway and induces a G2/M cell growth arrest in liver cells .
Author Notas G, Alexaki VI, Kampa M, Pelekanou V, Charalampopoulos I, Sabour-Alaoui S, Pediaditakis I, Dessirier V, Gravanis A, Stathopoulos EN, Tsapis A and Castanas E.
Journal J. Immunol. 189 (10), 4748-4758 (2012)
Title TACI and BCMA are receptors for a TNF homologue implicated in B-cell autoimmune disease .
Author Gross JA, Johnston J, Mudri S, Enselman R, Dillon SR, Madden K, Xu W, Parrish-Novak J, Foster D, Lofton-Day C, Moore M, Littau A, Grossman A, Haugen H, Foley K, Blumberg H, Harrison K, Kindsvogel W and Clegg CH.
Journal Nature 404 (6781), 995-999 (2000)
Title Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q .
Author Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC and Adams MD.
Journal Genomics 60 (3), 295-308 (1999)
Title BCMAp: an integral membrane protein in the Golgi apparatus of human mature B lymphocytes .
Author Gras MP, Laabi Y, Linares-Cruz G, Blondel MO, Rigaut JP, Brouet JC, Leca G, Haguenauer-Tsapis R and Tsapis A.
Journal Int. Immunol. 7 (7), 1093-1106 (1995)
Title The BCMA gene, preferentially expressed during B lymphoid maturation, is bidirectionally transcribed .
Author Laabi Y, Gras MP, Brouet JC, Berger R, Larsen CJ and Tsapis A.
Journal Nucleic Acids Res. 22 (7), 1147-1154 (1994)
Title A new gene, BCM, on chromosome 16 is fused to the interleukin 2 gene by a t(4;16)(q26;p13) translocation in a malignant T cell lymphoma .
Author Laabi Y, Gras MP, Carbonnel F, Brouet JC, Berger R, Larsen CJ and Tsapis A.
Journal EMBO J. 11 (11), 3897-3904 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.