• THAT   AND
  • THAT   AND


Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001192 Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA. Full Lenth $288.26
ORF Sequence $160.95


RefSeq Version NM_001192.2, 23238191
Length 994 bp
Structure linear
Update Date 13-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA.
Product tumor necrosis factor receptor superfamily member 17
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. [provided by RefSeq].

RefSeq NP_001183.2
CDS 219..773
Exon (1)1..348
Exon (2)1..348
Exon (3)349..495
Exon (4)496..994
Translation MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS ISAR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
69+a, gdbSNP:3743591
75+c, tdbSNP:11570139
213+g, tdbSNP:76315089
315+c, tdbSNP:118120349
379+c, tdbSNP:11570146
411+a, gdbSNP:11570147
441+g, tdbSNP:11570148
complement(460)-t, cdbSNP:373496
474+a, gdbSNP:17854965
631+c, tdbSNP:113898999
complement(651)-g, adbSNP:35682514
complement(674)-g, adbSNP:35434482
complement(695)-t, cdbSNP:2017662
712+c, gdbSNP:11570159
complement(743)-t, cdbSNP:2071336
complement(746)-g, cdbSNP:34546237
867+c, tdbSNP:113128674
889+c, gdbSNP:74008646
979+c, gdbSNP:1126889
979+ctc, gtctdbSNP:71389075
981..982+, tdbSNP:113542863
989..990+, tdbSNP:34223679
Gene SymbolTNFRSF17
Gene SynonymBCM; BCMA; CD269
Chromosome16
Locus Map16p13.1
All Transcripts NM_001192
Title Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut .
Author Lee,K.M., Baris,D., Zhang,Y., Hosgood,H.D. III, Menashe,I., Yeager,M., Zahm,S.H., Wang,S.S., Purdue,M.P., Chanock,S., Zheng,T., Rothman,N. and Lan,Q.
Journal Am. J. Hematol. 85 (8), 560-563 (2010)
Title Identification of single nucleotide polymorphisms in the TNFRSF17 gene and their association with gastrointestinal disorders .
Author Chae,S.C., Yu,J.I., Oh,G.J., Choi,C.S., Choi,S.C., Yang,Y.S. and Yun,K.J.
Journal Mol. Cells 29 (1), 21-28 (2010)
Title Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity .
Author Hosgood,H.D. III, Zhang,L., Shen,M., Berndt,S.I., Vermeulen,R., Li,G., Yin,S., Yeager,M., Yuenger,J., Rothman,N., Chanock,S., Smith,M. and Lan,Q.
Journal Occup Environ Med 66 (12), 848-853 (2009)
Title Gut-associated lymphoid tissue contains the molecular machinery to support T-cell-dependent and T-cell-independent class switch recombination .
Author Barone,F., Patel,P., Sanderson,J.D. and Spencer,J.
Journal Mucosal Immunol 2 (6), 495-503 (2009)
Title Local network topology in human protein interaction data predicts functional association .
Author Li,H. and Liang,S.
Journal PLoS ONE 4 (7), E6410 (2009)
Title TACI and BCMA are receptors for a TNF homologue implicated in B-cell autoimmune disease .
Author Gross,J.A., Johnston,J., Mudri,S., Enselman,R., Dillon,S.R., Madden,K., Xu,W., Parrish-Novak,J., Foster,D., Lofton-Day,C., Moore,M., Littau,A., Grossman,A., Haugen,H., Foley,K., Blumberg,H., Harrison,K., Kindsvogel,W. and Clegg,C.H.
Journal Nature 404 (6781), 995-999 (2000)
Title Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q .
Author Loftus,B.J., Kim,U.J., Sneddon,V.P., Kalush,F., Brandon,R., Fuhrmann,J., Mason,T., Crosby,M.L., Barnstead,M., Cronin,L., Deslattes Mays,A., Cao,Y., Xu,R.X., Kang,H.L., Mitchell,S., Eichler,E.E., Harris,P.C., Venter,J.C. and Adams,M.D.
Journal Genomics 60 (3), 295-308 (1999)
Title BCMAp: an integral membrane protein in the Golgi apparatus of human mature B lymphocytes .
Author Gras,M.P., Laabi,Y., Linares-Cruz,G., Blondel,M.O., Rigaut,J.P., Brouet,J.C., Leca,G., Haguenauer-Tsapis,R. and Tsapis,A.
Journal Int. Immunol. 7 (7), 1093-1106 (1995)
Title The BCMA gene, preferentially expressed during B lymphoid maturation, is bidirectionally transcribed .
Author Laabi,Y., Gras,M.P., Brouet,J.C., Berger,R., Larsen,C.J. and Tsapis,A.
Journal Nucleic Acids Res. 22 (7), 1147-1154 (1994)
Title A new gene, BCM, on chromosome 16 is fused to the interleukin 2 gene by a t(4;16)(q26;p13) translocation in a malignant T cell lymphoma .
Author Laabi,Y., Gras,M.P., Carbonnel,F., Brouet,J.C., Berger,R., Larsen,C.J. and Tsapis,A.
Journal EMBO J. 11 (11), 3897-3904 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878