• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001192 Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_001192.2, 23238191
Length 994 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA.
Product tumor necrosis factor receptor superfamily member 17
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. [provided by RefSeq, Jul 2008].

RefSeq NP_001183.2
CDS 219..773
Misc Feature(1)192..194
Misc Feature(2)225..230
Misc Feature(3)225..230
Misc Feature(4)237..341
Misc Feature(5)240..356
Misc Feature(6)381..449
Exon (1)1..348
Gene:TNFRSF17
Gene Synonym:BCM; BCMA; CD269
Exon (2)349..495
Gene:TNFRSF17
Gene Synonym:BCM; BCMA; CD269
Exon (3)496..994
Gene:TNFRSF17
Gene Synonym:BCM; BCMA; CD269
Translation MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS ISAR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
62+dbSNP:
62+c, tdbSNP:192605606
69+a, gdbSNP:3743591
75+c, tdbSNP:11570139
159+g, tdbSNP:151308896
251+c, tdbSNP:138231933
276+a, gdbSNP:143690193
297+c, tdbSNP:185085849
298+a, gdbSNP:200779776
306+g, tdbSNP:190015454
315+c, tdbSNP:118120349
373+dbSNP:
373+c, tdbSNP:140266790
379+c, tdbSNP:11570146
380+a, gdbSNP:200361156
394+a, g, tdbSNP:150754620
411+a, gdbSNP:11570147
414+a, gdbSNP:150048046
432+g, tdbSNP:146604927
441+c, g, tdbSNP:11570148
460+c, tdbSNP:373496
474+a, gdbSNP:17854965
479+c, tdbSNP:180992520
523+c, tdbSNP:143855487
527+c, tdbSNP:201708971
581+c, gdbSNP:146794298
583+c, tdbSNP:140545031
584+a, gdbSNP:183187632
626+a, gdbSNP:143643252
630+a, gdbSNP:199855585
631+c, tdbSNP:113898999
651+a, gdbSNP:35682514
664+g, tdbSNP:151074854
674+a, gdbSNP:35434482
675+a, gdbSNP:150352299
695+c, tdbSNP:2017662
708+g, tdbSNP:200613750
712+c, gdbSNP:11570159
743+c, tdbSNP:2071336
746+c, gdbSNP:34546237
752+a, gdbSNP:199882446
772+a, tdbSNP:201838370
867+c, tdbSNP:113128674
889+c, gdbSNP:74008646
978..979+, gtdbSNP:201064111
979+c, gdbSNP:1126889
979+ctc, gtctdbSNP:71389075
980..981+, tdbSNP:113542863
981+a, gdbSNP:201687396
989..990+, c, tdbSNP:34223679
Gene SymbolTNFRSF17
Gene SynonymBCM; BCMA; CD269
Chromosome16
Locus Map16p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001192 Homo sapiens tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), mRNA. On-demand $399.00 14
Title APRIL binding to BCMA activates a JNK2-FOXO3-GADD45 pathway and induces a G2/M cell growth arrest in liver cells .
Author Notas,G., Alexaki,V.I., Kampa,M., Pelekanou,V., Charalampopoulos,I., Sabour-Alaoui,S., Pediaditakis,I., Dessirier,V., Gravanis,A., Stathopoulos,E.N., Tsapis,A. and Castanas,E.
Journal J. Immunol. 189 (10), 4748-4758 (2012)
Title Serum B-cell maturation antigen is elevated in multiple myeloma and correlates with disease status and survival .
Author Sanchez,E., Li,M., Kitto,A., Li,J., Wang,C.S., Kirk,D.T., Yellin,O., Nichols,C.M., Dreyer,M.P., Ahles,C.P., Robinson,A., Madden,E., Waterman,G.N., Swift,R.A., Bonavida,B., Boccia,R., Vescio,R.A., Crowley,J., Chen,H. and Berenson,J.R.
Journal Br. J. Haematol. 158 (6), 727-738 (2012)
Title The haplotypes of TNFRSF17 polymorphisms are associated with colon cancer in a Korean population .
Author Chae,S.C., Yu,J.I., Uhm,T.B., Lee,S.Y., Kang,D.B., Lee,J.K., Park,W.C. and Yun,K.J.
Journal Int J Colorectal Dis 27 (6), 701-707 (2012)
Title B-cell maturation antigen (BCMA) activation exerts specific proinflammatory effects in normal human keratinocytes and is preferentially expressed in inflammatory skin pathologies .
Author Alexaki,V.I., Pelekanou,V., Notas,G., Venihaki,M., Kampa,M., Dessirier,V., Sabour-Alaoui,S., Stathopoulos,E.N., Tsapis,A. and Castanas,E.
Journal Endocrinology 153 (2), 739-749 (2012)
Title Aberrant expression of functional BAFF-system receptors by malignant B-cell precursors impacts leukemia cell survival .
Author Maia,S., Pelletier,M., Ding,J., Hsu,Y.M., Sallan,S.E., Rao,S.P., Nadler,L.M. and Cardoso,A.A.
Journal PLoS ONE 6 (6), E20787 (2011)
Title TACI and BCMA are receptors for a TNF homologue implicated in B-cell autoimmune disease .
Author Gross,J.A., Johnston,J., Mudri,S., Enselman,R., Dillon,S.R., Madden,K., Xu,W., Parrish-Novak,J., Foster,D., Lofton-Day,C., Moore,M., Littau,A., Grossman,A., Haugen,H., Foley,K., Blumberg,H., Harrison,K., Kindsvogel,W. and Clegg,C.H.
Journal Nature 404 (6781), 995-999 (2000)
Title Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q .
Author Loftus,B.J., Kim,U.J., Sneddon,V.P., Kalush,F., Brandon,R., Fuhrmann,J., Mason,T., Crosby,M.L., Barnstead,M., Cronin,L., Deslattes Mays,A., Cao,Y., Xu,R.X., Kang,H.L., Mitchell,S., Eichler,E.E., Harris,P.C., Venter,J.C. and Adams,M.D.
Journal Genomics 60 (3), 295-308 (1999)
Title BCMAp: an integral membrane protein in the Golgi apparatus of human mature B lymphocytes .
Author Gras,M.P., Laabi,Y., Linares-Cruz,G., Blondel,M.O., Rigaut,J.P., Brouet,J.C., Leca,G., Haguenauer-Tsapis,R. and Tsapis,A.
Journal Int. Immunol. 7 (7), 1093-1106 (1995)
Title The BCMA gene, preferentially expressed during B lymphoid maturation, is bidirectionally transcribed .
Author Laabi,Y., Gras,M.P., Brouet,J.C., Berger,R., Larsen,C.J. and Tsapis,A.
Journal Nucleic Acids Res. 22 (7), 1147-1154 (1994)
Title A new gene, BCM, on chromosome 16 is fused to the interleukin 2 gene by a t(4;16)(q26;p13) translocation in a malignant T cell lymphoma .
Author Laabi,Y., Gras,M.P., Carbonnel,F., Brouet,J.C., Berger,R., Larsen,C.J. and Tsapis,A.
Journal EMBO J. 11 (11), 3897-3904 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.