• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001193466 Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $1198.00 $1149.00 16

*Business Day

Related Services

RefSeq Version NM_001193466.1, 301500644
Length 5357 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 1, mRNA.
Product KAT8 regulatory NSL complex subunit 1 isoform 1
Comment

Summary: This gene encodes a nuclear protein that is a subunit of two protein complexes involved with histone acetylation, the MLL1 complex and the NSL1 complex. The corresponding protein in Drosophila interacts with K(lysine) acetyltransferase 8, which is also a subunit of both the MLL1 and NSL1 complexes. [provided by RefSeq, Jun 2012].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (1). Variants 1 and 2 encode the same protein.

RefSeq NP_001180395.1
CDS 472..3789
Misc Feature(1)469..471
Misc Feature(2)781..783
Misc Feature(3)781..783
Misc Feature(4)1216..1218
Misc Feature(5)1273..1275
Misc Feature(6)3019..3117
Misc Feature(7)3118..3786
Misc Feature(8)3124..3576
Misc Feature(9)3442..3444
Misc Feature(10)3478..3480
Misc Feature(11)3604..3606
Exon (1)1..382
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (2)383..1760
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (3)1761..1902
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (4)1903..2004
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (5)2005..2123
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (6)2124..2319
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (7)2320..2491
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (8)2492..2674
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (9)2675..2863
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (10)2864..3012
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (11)3013..3137
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (12)3138..3195
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (13)3196..3308
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (14)3309..3561
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (15)3562..5349
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Translation MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILIAANGTKRKAIAAEDPS LDFRNNPTKEDLGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYEL RAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGK RALTSSALHGGEMGGSESGDLKGGMTNCTLPHRSLDVEHTTLYSNNSTANKSSVNSMEQP ALQGSSRLSPGTDSSSNLGGVKLEGKKSPLSSILFSALDSDTRITALLRRQADIESRARR LQKRLQVVQAKQVERHIQHQLGGFLEKTLSKLPNLESLRPRSQLMLTRKAEAALRKAASE TTTSEGLSNFLKSNSISEELERFTASGIANLRCSEQAFDSDVTDSSSGGESDIEEEELTR ADPEQRHVPLRRRSEWKWAADRAAIVSRWNWLQAHVSDLEYRIRQQTDIYKQIRANKGLI VLGEVPPPEHTTDLFLPLSSEVKTDHGTDKLIESVSQPLENHGAPIIGHISESLSTKSCG ALRPVNGVINTLQPVLADHIPGDSSDAEEQLHKKQRLNLVSSSSDGTCVAARTRPVLSCK KRRLVRPNSIVPLSKKVHRNSTIRPGCDVNPSCALCGSGSINTMPPEIHYEAPLLERLSQ LDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSAR KDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHD PNHSKMRLRDHSSERSEVLKHHTDMSSSSYLAATHHPPHSPLVRQLSTSSDSPAPASSSS QVTASTSQQPVRRRRGESSFDINNIVIPMSVAATTRVEKLQYKEILTPSWREVDLQSLKG SPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLG SANPSTPQPASPDVSSSHSLSEYSHGQSPRSPISPELHSAPLTPVARDTPRHLASEDTRC STPELGLDEQSVQPWERRTFPLAHSPQAECEDQLDAQERAARCTRRTSGSKTGRETEAAP TSPPIVPLKSRHLVAAATAQRPTHR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(11..13)-dbSNP:
complement(11..13)-, aggdbSNP:143625699
complement(65)-g, adbSNP:144753624
108+a, tdbSNP:2696633
complement(203)-t, adbSNP:11079733
complement(245)-t, cdbSNP:62060947
complement(262)-t, cdbSNP:180814097
complement(406)-dbSNP:
complement(406)-t, cdbSNP:374090769
complement(431)-g, adbSNP:376385390
complement(437)-g, adbSNP:200079769
complement(438)-t, cdbSNP:369409842
complement(479)-g, adbSNP:376233244
complement(483)-t, cdbSNP:146472353
complement(501)-g, adbSNP:200649587
complement(574)-t, cdbSNP:369793673
complement(589)-t, cdbSNP:376632173
complement(593)-t, cdbSNP:142587760
complement(595)-t, cdbSNP:139934691
complement(613)-t, cdbSNP:148847759
complement(674)-g, adbSNP:145477492
complement(757)-g, adbSNP:140268765
complement(768)-t, cdbSNP:34801822
complement(787)-t, cdbSNP:371450753
complement(805)-g, adbSNP:201016790
complement(913)-t, cdbSNP:140089320
complement(939)-g, cdbSNP:150877831
complement(948)-c, adbSNP:188294801
complement(969)-t, gdbSNP:141491325
complement(996)-g, adbSNP:148321376
complement(1012)-g, adbSNP:375225315
complement(1026)-t, cdbSNP:199498626
complement(1042)-c, adbSNP:149566146
complement(1078)-g, cdbSNP:138175526
complement(1090)-t, cdbSNP:372601814
complement(1091)-t, cdbSNP:144882998
complement(1106)-t, cdbSNP:141110759
complement(1107)-g, adbSNP:368300062
complement(1133)-g, adbSNP:17662853
complement(1151)-t, cdbSNP:150345690
complement(1154)-g, cdbSNP:188477102
complement(1159)-t, cdbSNP:34756740
complement(1172)-g, adbSNP:199948200
complement(1194)-t, cdbSNP:375054119
complement(1195)-t, gdbSNP:372293710
complement(1198)-t, gdbSNP:142096969
complement(1207)-t, cdbSNP:141969887
complement(1225)-t, cdbSNP:368487719
complement(1244)-g, adbSNP:145714368
complement(1245)-t, cdbSNP:202232945
complement(1271)-t, cdbSNP:140181991
complement(1276)-g, adbSNP:200903841
complement(1319)-t, cdbSNP:199737786
complement(1333)-g, adbSNP:144805634
complement(1336)-g, adbSNP:373759089
complement(1339)-g, adbSNP:149830411
complement(1364)-g, adbSNP:149363799
complement(1367)-t, cdbSNP:201785695
1387+c, tdbSNP:281865468
complement(1420)-t, cdbSNP:139843442
1456..1457+, ttdbSNP:281865473
1482+c, gdbSNP:2240758
complement(1484)-g, adbSNP:200997135
complement(1492)-g, adbSNP:373918467
complement(1493)-t, cdbSNP:371321182
complement(1547)-t, cdbSNP:376770281
complement(1558)-t, cdbSNP:138704004
complement(1577)-t, cdbSNP:139564524
complement(1581)-g, adbSNP:374053775
complement(1587)-g, adbSNP:62639965
complement(1595)-g, adbSNP:142696045
complement(1599)-t, adbSNP:148054472
complement(1616)-g, cdbSNP:369920825
complement(1628)-c, adbSNP:143589497
complement(1637)-g, adbSNP:368394693
complement(1656)-t, cdbSNP:199820469
complement(1658)-t, adbSNP:149302199
complement(1660)-t, cdbSNP:138565467
complement(1732)-t, cdbSNP:150115249
complement(1736)-t, adbSNP:191058987
complement(1756)-t, gdbSNP:142062936
complement(1769)-dbSNP:
complement(1769)-t, cdbSNP:191513954
complement(1795)-g, adbSNP:200720272
complement(1802..1803)-, gdbSNP:34282543
complement(1921..1922)-dbSNP:
complement(1921..1922)-, cdbSNP:34878385
complement(1925)-g, adbSNP:371655539
complement(1957)-g, cdbSNP:369370288
complement(1962)-t, cdbSNP:17576165
complement(1992)-t, cdbSNP:146927357
complement(1994)-t, gdbSNP:375555532
complement(2023)-dbSNP:
complement(2023)-g, adbSNP:201062044
complement(2045)-g, cdbSNP:144838667
complement(2047)-t, adbSNP:370560721
complement(2061)-t, adbSNP:151329554
complement(2064)-t, cdbSNP:377097643
complement(2076)-g, adbSNP:200561483
complement(2084)-g, adbSNP:142435060
complement(2108)-t, cdbSNP:148770530
complement(2117)-g, adbSNP:145343407
complement(2125)-dbSNP:
complement(2125)-t, gdbSNP:144337302
complement(2138)-c, adbSNP:200449833
complement(2156)-t, cdbSNP:369324570
2160+c, tdbSNP:113557856
complement(2165)-g, cdbSNP:146310615
complement(2209)-t, cdbSNP:117412152
complement(2250)-t, cdbSNP:372072783
complement(2280)-g, cdbSNP:369472164
2287+c, tdbSNP:281865469
complement(2293)-t, adbSNP:375533550
complement(2297)-t, cdbSNP:138698439
complement(2299)-t, cdbSNP:147195653
complement(2301)-g, adbSNP:150800846
complement(2302)-t, cdbSNP:202150313
complement(2326)-dbSNP:
complement(2326)-g, adbSNP:141298741
complement(2328)-g, c, adbSNP:191986791
complement(2330)-t, gdbSNP:200979425
2338..2341+, atccdbSNP:281865472
complement(2341)-g, adbSNP:368180304
complement(2353)-g, cdbSNP:375256880
complement(2370)-g, adbSNP:148259171
complement(2371)-t, cdbSNP:145938212
complement(2409)-g, adbSNP:371047711
complement(2460)-g, adbSNP:368175458
complement(2462)-c, adbSNP:368245340
complement(2568)-dbSNP:
complement(2568)-g, adbSNP:147497178
complement(2577)-g, cdbSNP:371108710
complement(2580)-t, cdbSNP:34101027
complement(2581)-g, adbSNP:202231419
complement(2601)-g, adbSNP:190201507
complement(2607)-t, cdbSNP:2277613
complement(2623)-g, adbSNP:34043286
complement(2629)-g, adbSNP:376233499
complement(2630)-t, cdbSNP:148825937
complement(2661)-g, adbSNP:145434865
2668+g, tdbSNP:80026189
complement(2695)-dbSNP:
complement(2695)-g, adbSNP:150282556
complement(2701)-g, cdbSNP:200103894
complement(2733)-t, cdbSNP:141092796
complement(2765)-g, adbSNP:151099014
complement(2769)-t, cdbSNP:367624499
complement(2780)-t, cdbSNP:144377285
complement(2802)-g, adbSNP:139663254
complement(2833)-g, adbSNP:146821414
complement(2884)-dbSNP:
complement(2884)-t, cdbSNP:184281762
complement(2885)-g, adbSNP:201526313
complement(2894)-g, adbSNP:372105810
complement(2921)-g, cdbSNP:200086055
2950+c, tdbSNP:11539538
complement(2952)-g, adbSNP:143653891
complement(2961)-t, cdbSNP:200903355
complement(3009)-t, cdbSNP:148718200
complement(3012)-t, cdbSNP:200079722
complement(3051)-dbSNP:
complement(3051)-g, adbSNP:17574604
complement(3099)-g, adbSNP:149756887
complement(3157)-dbSNP:
complement(3157)-g, adbSNP:143533965
3169+a, c, g, tdbSNP:74867664
complement(3189)-c, adbSNP:139615350
complement(3213)-dbSNP:
complement(3213)-t, g, c, adbSNP:35833914
complement(3222)-t, g, c, adbSNP:36076725
complement(3225)-g, adbSNP:138070874
3256..3257+, agdbSNP:281865471
complement(3262)-g, adbSNP:377108187
complement(3279)-t, cdbSNP:372559911
complement(3291)-g, adbSNP:200373370
complement(3332)-dbSNP:
complement(3332)-t, cdbSNP:376635152
complement(3343)-g, adbSNP:147378906
complement(3420)-g, adbSNP:146848167
complement(3456)-t, cdbSNP:371484505
complement(3491)-t, cdbSNP:148203818
complement(3499)-g, cdbSNP:143018360
complement(3500)-g, adbSNP:7220988
complement(3509)-g, adbSNP:138490347
complement(3524)-g, adbSNP:145863194
complement(3600)-dbSNP:
complement(3600)-t, cdbSNP:140670092
complement(3614)-g, adbSNP:200719065
complement(3639)-t, adbSNP:372299492
complement(3641)-t, cdbSNP:201083879
complement(3668)-t, cdbSNP:368475798
complement(3707)-g, adbSNP:370112084
complement(3709)-g, adbSNP:199769766
complement(3725)-g, adbSNP:34579536
complement(3735)-g, adbSNP:370904425
complement(3777)-c, adbSNP:143746890
complement(3792)-t, cdbSNP:372125138
complement(3823..3826)-, aatadbSNP:373668834
complement(3930)-t, adbSNP:76025910
complement(3939)-g, adbSNP:78288850
4006+a, gdbSNP:140200874
complement(4114)-g, adbSNP:112051212
complement(4144..4145)-, tctdbSNP:200384907
complement(4177)-c, adbSNP:367998611
complement(4211)-t, gdbSNP:182071752
complement(4214)-, gdbSNP:372355931
complement(4231)-t, cdbSNP:144386890
complement(4237)-g, adbSNP:149673847
complement(4249)-g, adbSNP:191706665
complement(4263)-t, gdbSNP:186913097
complement(4276)-g, adbSNP:17652961
complement(4292..4293)-, gdbSNP:35349036
complement(4332)-t, cdbSNP:182060151
4385+c, gdbSNP:139454638
complement(4429)-g, adbSNP:17574361
complement(4531)-t, cdbSNP:7350928
complement(4661)-t, adbSNP:77877023
complement(4673..4674)-, adbSNP:5820607
complement(4674..4675)-, adbSNP:35400776
4743+c, gdbSNP:150500194
complement(4750)-t, g, cdbSNP:113829708
4816+c, gdbSNP:11870461
complement(4817)-g, adbSNP:375427074
complement(4862)-t, cdbSNP:28553921
complement(4881..4882)-, agdbSNP:374923391
complement(4885)-g, adbSNP:189466615
complement(4892..4893)-, adbSNP:142756815
4943+g, tdbSNP:11539537
4985+a, cdbSNP:137970866
complement(5025..5026)-, tdbSNP:140510364
complement(5061)-c, adbSNP:183793920
complement(5108)-, adbSNP:66496366
5178+a, tdbSNP:11539536
complement(5199)-t, cdbSNP:7502673
complement(5277)-t, cdbSNP:147415592
5284+a, cdbSNP:1047606
complement(5284)-c, adbSNP:386513179
complement(5309)-, tdbSNP:371902677
complement(5310)-g, adbSNP:11539535
complement(5311..5313)-, cttdbSNP:373637126
complement(5321)-c, adbSNP:142803832
Gene SymbolKANSL1
Gene SynonymCENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Chromosome17
Locus Map17q21.31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_015443 Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 2, mRNA. In-stock $1198.00 $1149.00 16
NM_001193465 Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 3, mRNA. On-demand $1699.00 25
NM_001193466 Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 1, mRNA. In-stock $1198.00 $1149.00 16
XM_006721823 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X1, mRNA. On-demand $1699.00 25
XM_006721824 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X2, mRNA. On-demand $1699.00 25
XM_006721825 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X3, mRNA. On-demand $1699.00 25
XM_006721826 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X4, mRNA. On-demand $1699.00 25
XM_005275644 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X1, mRNA. On-demand $1699.00 25
XM_005275645 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X2, mRNA. On-demand $1699.00 25
XM_006725263 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X3, mRNA. On-demand $1699.00 25
XM_006725264 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X4, mRNA. On-demand $1699.00 25
XM_005257232 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X1, mRNA. On-demand $1699.00 25
XM_005257233 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X2, mRNA. On-demand $1699.00 25
XM_005257234 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X3, mRNA. On-demand $1699.00 25
XM_005257235 PREDICTED: Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant X4, mRNA. On-demand $1699.00 25
Title Mutations in KANSL1 cause the 17q21.31 microdeletion syndrome phenotype .
Author Zollino M, Orteschi D, Murdolo M, Lattante S, Battaglia D, Stefanini C, Mercuri E, Chiurazzi P, Neri G and Marangi G.
Journal Nat. Genet. 44 (6), 636-638 (2012)
Title Common variants at 6q22 and 17q21 are associated with intracranial volume .
Author Ikram MA, Fornage M, Smith AV, Seshadri S, Schmidt R, Debette S, Vrooman HA, Sigurdsson S, Ropele S, Taal HR, Mook-Kanamori DO, Coker LH, Longstreth WT Jr, Niessen WJ, DeStefano AL, Beiser A, Zijdenbos AP, Struchalin M, Jack CR Jr, Rivadeneira F, Uitterlinden AG, Knopman DS, Hartikainen AL, Pennell CE, Thiering E, Steegers EA, Hakonarson H, Heinrich J, Palmer LJ, Jarvelin MR, McCarthy MI, Grant SF, St Pourcain B, Timpson NJ, Smith GD, Sovio U, Nalls MA, Au R, Hofman A, Gudnason H, van der Lugt A, Harris TB, Meeks WM, Vernooij MW, van Buchem MA, Catellier D, Jaddoe VW, Gudnason V, Windham BG, Wolf PA, van Duijn CM, Mosley TH Jr, Schmidt H, Launer LJ, Breteler MM and DeCarli C.
Journal Nat. Genet. 44 (5), 539-544 (2012)
Title MOF and H4 K16 acetylation play important roles in DNA damage repair by modulating recruitment of DNA damage repair protein Mdc1 .
Author Li X, Corsa CA, Pan PW, Wu L, Ferguson D, Yu X, Min J and Dou Y.
Journal Mol. Cell. Biol. 30 (22), 5335-5347 (2010)
Title Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex .
Author Cai Y, Jin J, Swanson SK, Cole MD, Choi SH, Florens L, Washburn MP, Conaway JW and Conaway RC.
Journal J. Biol. Chem. 285 (7), 4268-4272 (2010)
Title Two mammalian MOF complexes regulate transcription activation by distinct mechanisms .
Author Li X, Wu L, Corsa CA, Kunkel S and Dou Y.
Journal Mol. Cell 36 (2), 290-301 (2009)
Title Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF .
Author Dou Y, Milne TA, Tackett AJ, Smith ER, Fukuda A, Wysocka J, Allis CD, Chait BT, Hess JL and Roeder RG.
Journal Cell 121 (6), 873-885 (2005)
Title Large-scale characterization of HeLa cell nuclear phosphoproteins .
Author Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC and Gygi SP.
Journal Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 (2004)
Title A genomic sequence analysis of the mouse and human microtubule-associated protein tau .
Author Poorkaj P, Kas A, D'Souza I, Zhou Y, Pham Q, Stone M, Olson MV and Schellenberg GD.
Journal Mamm. Genome 12 (9), 700-712 (2001)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson JC, Wellenreuther R, Poustka A, Pepperkok R and Wiemann S.
Journal EMBO Rep. 1 (3), 287-292 (2000)
Title KANSL1-Related Intellectual Disability Syndrome .
Author Koolen,D.A. and de Vries,B.B.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.