• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001193466 Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $1198.00 $1149.00 16

*Business Day

Related Services

RefSeq Version NM_001193466.1, 301500644
Length 5357 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 1, mRNA.
Product KAT8 regulatory NSL complex subunit 1 isoform 1
Comment

Summary: This gene encodes a nuclear protein that is a subunit of two protein complexes involved with histone acetylation, the MLL1 complex and the NSL1 complex. The corresponding protein in Drosophila interacts with K(lysine) acetyltransferase 8, which is also a subunit of both the MLL1 and NSL1 complexes. [provided by RefSeq, Jun 2012].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (1). Variants 1 and 2 encode the same protein.

RefSeq NP_001180395.1
CDS 472..3789
Misc Feature(1)469..471
Misc Feature(2)3118..3786
Misc Feature(3)3118..3786
Exon (1)1..382
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (2)383..1760
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (3)1761..1902
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (4)1903..2004
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (5)2005..2123
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (6)2124..2319
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (7)2320..2491
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (8)2492..2674
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (9)2675..2863
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (10)2864..3012
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (11)3013..3137
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (12)3138..3195
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (13)3196..3308
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (14)3309..3561
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Exon (15)3562..5349
Gene:KANSL1
Gene Synonym:CENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Translation MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILIAANGTKRKAIAAEDPS LDFRNNPTKEDLGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYEL RAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGK RALTSSALHGGEMGGSESGDLKGGMTNCTLPHRSLDVEHTTLYSNNSTANKSSVNSMEQP ALQGSSRLSPGTDSSSNLGGVKLEGKKSPLSSILFSALDSDTRITALLRRQADIESRARR LQKRLQVVQAKQVERHIQHQLGGFLEKTLSKLPNLESLRPRSQLMLTRKAEAALRKAASE TTTSEGLSNFLKSNSISEELERFTASGIANLRCSEQAFDSDVTDSSSGGESDIEEEELTR ADPEQRHVPLRRRSEWKWAADRAAIVSRWNWLQAHVSDLEYRIRQQTDIYKQIRANKGLI VLGEVPPPEHTTDLFLPLSSEVKTDHGTDKLIESVSQPLENHGAPIIGHISESLSTKSCG ALRPVNGVINTLQPVLADHIPGDSSDAEEQLHKKQRLNLVSSSSDGTCVAARTRPVLSCK KRRLVRPNSIVPLSKKVHRNSTIRPGCDVNPSCALCGSGSINTMPPEIHYEAPLLERLSQ LDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSAR KDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHD PNHSKMRLRDHSSERSEVLKHHTDMSSSSYLAATHHPPHSPLVRQLSTSSDSPAPASSSS QVTASTSQQPVRRRRGESSFDINNIVIPMSVAATTRVEKLQYKEILTPSWREVDLQSLKG SPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLG SANPSTPQPASPDVSSSHSLSEYSHGQSPRSPISPELHSAPLTPVARDTPRHLASEDTRC STPELGLDEQSVQPWERRTFPLAHSPQAECEDQLDAQERAARCTRRTSGSKTGRETEAAP TSPPIVPLKSRHLVAAATAQRPTHR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(9..11)-dbSNP:
complement(9..11)-, gagdbSNP:55813005
complement(11..13)-, aggdbSNP:143625699
complement(65)-g, adbSNP:144753624
complement(108)-t, adbSNP:2696633
complement(203)-t, adbSNP:11079733
complement(245)-t, cdbSNP:62060947
complement(262)-t, cdbSNP:180814097
complement(323..327)-, agaagdbSNP:75385512
complement(326..330)-, aagagdbSNP:141752007
complement(437)-dbSNP:
complement(437)-g, adbSNP:200079769
complement(483)-t, cdbSNP:146472353
complement(501)-g, adbSNP:200649587
complement(593)-t, cdbSNP:142587760
complement(595)-t, cdbSNP:139934691
complement(613)-t, cdbSNP:148847759
complement(674)-g, adbSNP:145477492
complement(725)-g, cdbSNP:34613356
complement(748)-t, cdbSNP:149661150
complement(757)-g, adbSNP:140268765
complement(767)-t, cdbSNP:147330210
complement(768)-t, cdbSNP:34801822
complement(782)-t, gdbSNP:17585974
complement(805)-g, adbSNP:201016790
complement(885)-c, adbSNP:17662889
complement(913)-t, cdbSNP:140089320
complement(939)-g, cdbSNP:150877831
complement(948)-c, adbSNP:188294801
complement(969)-t, gdbSNP:141491325
complement(996)-g, adbSNP:148321376
complement(1001)-t, cdbSNP:144270733
complement(1026)-t, cdbSNP:199498626
complement(1042)-c, adbSNP:149566146
complement(1078)-g, cdbSNP:138175526
complement(1091)-t, cdbSNP:144882998
complement(1106)-t, cdbSNP:141110759
complement(1133)-g, adbSNP:17662853
complement(1144)-t, cdbSNP:35643216
complement(1151)-t, cdbSNP:150345690
complement(1154)-g, cdbSNP:188477102
complement(1159)-t, cdbSNP:34756740
complement(1167)-g, adbSNP:1881194
complement(1172)-g, adbSNP:199948200
complement(1198)-t, gdbSNP:142096969
complement(1207)-t, cdbSNP:141969887
complement(1212)-t, cdbSNP:1881193
complement(1244)-g, adbSNP:145714368
complement(1245)-t, cdbSNP:202232945
complement(1271)-t, cdbSNP:140181991
complement(1276)-g, adbSNP:200903841
complement(1319)-t, cdbSNP:199737786
complement(1333)-g, adbSNP:144805634
complement(1339)-g, adbSNP:149830411
complement(1364)-g, adbSNP:149363799
complement(1367)-t, cdbSNP:201785695
1387+c, tdbSNP:281865468
complement(1420)-t, cdbSNP:139843442
1456..1457+, ttdbSNP:281865473
complement(1471)-t, cdbSNP:112150341
complement(1482)-g, cdbSNP:2240758
complement(1484)-g, adbSNP:200997135
complement(1558)-t, cdbSNP:138704004
complement(1577)-t, cdbSNP:139564524
complement(1587)-g, adbSNP:62639965
complement(1595)-g, adbSNP:142696045
complement(1599)-t, adbSNP:148054472
complement(1628)-c, adbSNP:143589497
complement(1656)-t, cdbSNP:199820469
complement(1658)-t, adbSNP:149302199
complement(1660)-t, cdbSNP:138565467
complement(1732)-t, cdbSNP:150115249
complement(1736)-t, adbSNP:191058987
complement(1756)-t, gdbSNP:142062936
complement(1769)-dbSNP:
complement(1769)-t, cdbSNP:191513954
complement(1795)-g, adbSNP:200720272
complement(1802..1803)-, gdbSNP:34282543
complement(1923..1924)-dbSNP:
complement(1923..1924)-, cdbSNP:34878385
complement(1962)-t, cdbSNP:17576165
complement(1992)-t, cdbSNP:146927357
complement(2023)-dbSNP:
complement(2023)-g, adbSNP:201062044
complement(2045)-g, cdbSNP:144838667
complement(2061)-t, adbSNP:151329554
complement(2076)-g, adbSNP:200561483
complement(2084)-g, adbSNP:142435060
complement(2108)-t, cdbSNP:148770530
complement(2117)-g, adbSNP:145343407
complement(2125)-dbSNP:
complement(2125)-t, gdbSNP:144337302
complement(2138)-c, adbSNP:200449833
complement(2160)-t, cdbSNP:113557856
complement(2165)-g, cdbSNP:146310615
complement(2209)-t, cdbSNP:117412152
2287+c, tdbSNP:281865469
complement(2297)-t, cdbSNP:138698439
complement(2299)-t, cdbSNP:147195653
complement(2301)-g, adbSNP:150800846
complement(2302)-t, cdbSNP:202150313
complement(2326)-dbSNP:
complement(2326)-g, adbSNP:141298741
complement(2328)-g, cdbSNP:191986791
complement(2330)-t, gdbSNP:200979425
2338..2341+, atccdbSNP:281865472
complement(2370)-g, adbSNP:148259171
complement(2371)-t, cdbSNP:145938212
complement(2568)-dbSNP:
complement(2568)-g, adbSNP:147497178
complement(2580)-t, cdbSNP:34101027
complement(2581)-g, adbSNP:202231419
complement(2601)-g, adbSNP:190201507
complement(2607)-t, cdbSNP:2277613
complement(2623)-g, adbSNP:34043286
complement(2630)-t, cdbSNP:148825937
complement(2661)-g, adbSNP:145434865
complement(2668)-t, gdbSNP:80026189
complement(2695)-dbSNP:
complement(2695)-g, adbSNP:150282556
complement(2701)-g, cdbSNP:200103894
complement(2733)-t, cdbSNP:141092796
complement(2765)-g, adbSNP:151099014
complement(2780)-t, cdbSNP:144377285
complement(2802)-g, adbSNP:139663254
complement(2833)-g, adbSNP:146821414
complement(2884)-dbSNP:
complement(2884)-t, cdbSNP:184281762
complement(2885)-g, adbSNP:201526313
complement(2921)-g, cdbSNP:200086055
complement(2950)-t, cdbSNP:11539538
complement(2952)-g, adbSNP:143653891
complement(2961)-t, cdbSNP:200903355
complement(3009)-t, cdbSNP:148718200
complement(3012)-t, cdbSNP:200079722
complement(3051)-dbSNP:
complement(3051)-g, adbSNP:17574604
complement(3099)-g, adbSNP:149756887
complement(3157)-dbSNP:
complement(3157)-g, adbSNP:143533965
complement(3169)-g, adbSNP:74867664
complement(3189)-c, adbSNP:139615350
complement(3213)-dbSNP:
complement(3213)-t, g, c, adbSNP:35833914
complement(3222)-t, g, c, adbSNP:36076725
complement(3225)-g, adbSNP:138070874
3256..3257+, agdbSNP:281865471
complement(3291)-g, adbSNP:200373370
complement(3343)-dbSNP:
complement(3343)-g, adbSNP:147378906
complement(3420)-g, adbSNP:146848167
complement(3491)-t, cdbSNP:148203818
complement(3499)-g, cdbSNP:143018360
complement(3500)-g, adbSNP:7220988
complement(3509)-g, adbSNP:138490347
complement(3524)-g, adbSNP:145863194
complement(3600)-dbSNP:
complement(3600)-t, cdbSNP:140670092
complement(3614)-g, adbSNP:200719065
complement(3641)-t, cdbSNP:201083879
complement(3709)-g, adbSNP:199769766
complement(3725)-g, adbSNP:34579536
complement(3777)-c, adbSNP:143746890
complement(3930)-t, adbSNP:76025910
complement(3939)-g, adbSNP:78288850
complement(4006)-g, adbSNP:140200874
complement(4114)-g, adbSNP:112051212
complement(4143..4144)-, tctgcccdbSNP:66486625
complement(4144..4145)-, tctdbSNP:200384907
complement(4147..4148)-, gccctct, ccdbSNP:67780127
complement(4148..4149)-, gccctct, agagggcdbSNP:113448888
complement(4211)-t, gdbSNP:182071752
complement(4231)-t, cdbSNP:144386890
complement(4237)-g, adbSNP:149673847
complement(4249)-g, adbSNP:191706665
complement(4263)-t, gdbSNP:186913097
complement(4276)-g, adbSNP:17652961
complement(4294..4295)-, gdbSNP:35349036
complement(4332)-t, cdbSNP:182060151
complement(4385)-g, cdbSNP:139454638
complement(4429)-g, adbSNP:17574361
complement(4531)-t, cdbSNP:7350928
complement(4661)-t, adbSNP:77877023
complement(4673..4674)-, adbSNP:5820607
complement(4674..4675)-, adbSNP:35400776
complement(4743)-g, cdbSNP:150500194
complement(4750)-t, g, cdbSNP:113829708
complement(4816)-g, cdbSNP:11870461
complement(4862)-t, cdbSNP:28553921
complement(4885)-g, adbSNP:189466615
complement(4892..4893)-, adbSNP:142756815
complement(4943)-t, gdbSNP:11539537
complement(4985)-c, adbSNP:137970866
complement(5023..5024)-, tdbSNP:66712646
complement(5025..5026)-, tdbSNP:140510364
complement(5061)-c, adbSNP:183793920
complement(5108)-, t, adbSNP:66496366
complement(5117)-, t, adbSNP:71665335
complement(5143)-, tdbSNP:67641084
complement(5178)-t, adbSNP:11539536
complement(5199)-t, cdbSNP:7502673
complement(5277)-t, cdbSNP:147415592
complement(5284)-c, adbSNP:1047606
complement(5308..5309)-, ttdbSNP:75187918
complement(5309)-, tdbSNP:67801660
complement(5309)-t, cdbSNP:75210291
complement(5310)-g, adbSNP:11539535
complement(5321)-c, adbSNP:142803832
Gene SymbolKANSL1
Gene SynonymCENP-36; hMSL1v1; KDVS; KIAA1267; MSL1v1; NSL1
Chromosome17
Locus Map17q21.31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001193465 Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 3, mRNA. On-demand $1699.00 25
NM_001193466 Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 1, mRNA. In-stock $1198.00 $1149.00 16
NM_015443 Homo sapiens KAT8 regulatory NSL complex subunit 1 (KANSL1), transcript variant 2, mRNA. In-stock $1198.00 $1149.00 16
Title Mutations in KANSL1 cause the 17q21.31 microdeletion syndrome phenotype .
Author Zollino,M., Orteschi,D., Murdolo,M., Lattante,S., Battaglia,D., Stefanini,C., Mercuri,E., Chiurazzi,P., Neri,G. and Marangi,G.
Journal Nat. Genet. 44 (6), 636-638 (2012)
Title Common variants at 6q22 and 17q21 are associated with intracranial volume .
Author Ikram,M.A., Fornage,M., Smith,A.V., Seshadri,S., Schmidt,R., Debette,S., Vrooman,H.A., Sigurdsson,S., Ropele,S., Taal,H.R., Mook-Kanamori,D.O., Coker,L.H., Longstreth,W.T. Jr., Niessen,W.J., DeStefano,A.L., Beiser,A., Zijdenbos,A.P., Struchalin,M., Jack,C.R. Jr., Rivadeneira,F., Uitterlinden,A.G., Knopman,D.S., Hartikainen,A.L., Pennell,C.E., Thiering,E., Steegers,E.A., Hakonarson,H., Heinrich,J., Palmer,L.J., Jarvelin,M.R., McCarthy,M.I., Grant,S.F., St Pourcain,B., Timpson,N.J., Smith,G.D., Sovio,U., Nalls,M.A., Au,R., Hofman,A., Gudnason,H., van der Lugt,A., Harris,T.B., Meeks,W.M., Vernooij,M.W., van Buchem,M.A., Catellier,D., Jaddoe,V.W., Gudnason,V., Windham,B.G., Wolf,P.A., van Duijn,C.M., Mosley,T.H. Jr., Schmidt,H., Launer,L.J., Breteler,M.M. and DeCarli,C.
Journal Nat. Genet. 44 (5), 539-544 (2012)
Title MOF and H4 K16 acetylation play important roles in DNA damage repair by modulating recruitment of DNA damage repair protein Mdc1 .
Author Li,X., Corsa,C.A., Pan,P.W., Wu,L., Ferguson,D., Yu,X., Min,J. and Dou,Y.
Journal Mol. Cell. Biol. 30 (22), 5335-5347 (2010)
Title Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex .
Author Cai,Y., Jin,J., Swanson,S.K., Cole,M.D., Choi,S.H., Florens,L., Washburn,M.P., Conaway,J.W. and Conaway,R.C.
Journal J. Biol. Chem. 285 (7), 4268-4272 (2010)
Title Two mammalian MOF complexes regulate transcription activation by distinct mechanisms .
Author Li,X., Wu,L., Corsa,C.A., Kunkel,S. and Dou,Y.
Journal Mol. Cell 36 (2), 290-301 (2009)
Title A human protein complex homologous to the Drosophila MSL complex is responsible for the majority of histone H4 acetylation at lysine 16 .
Author Smith,E.R., Cayrou,C., Huang,R., Lane,W.S., Cote,J. and Lucchesi,J.C.
Journal Mol. Cell. Biol. 25 (21), 9175-9188 (2005)
Title Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF .
Author Dou,Y., Milne,T.A., Tackett,A.J., Smith,E.R., Fukuda,A., Wysocka,J., Allis,C.D., Chait,B.T., Hess,J.L. and Roeder,R.G.
Journal Cell 121 (6), 873-885 (2005)
Title Large-scale characterization of HeLa cell nuclear phosphoproteins .
Author Beausoleil,S.A., Jedrychowski,M., Schwartz,D., Elias,J.E., Villen,J., Li,J., Cohn,M.A., Cantley,L.C. and Gygi,S.P.
Journal Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 (2004)
Title A genomic sequence analysis of the mouse and human microtubule-associated protein tau .
Author Poorkaj,P., Kas,A., D'Souza,I., Zhou,Y., Pham,Q., Stone,M., Olson,M.V. and Schellenberg,G.D.
Journal Mamm. Genome 12 (9), 700-712 (2001)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and Wiemann,S.
Journal EMBO Rep. 1 (3), 287-292 (2000)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.