• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001193471 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_001193471.1, 301500667
Length 2737 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, mRNA.
Product glutamate carboxypeptidase 2 isoform 3
Comment

Summary: This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms. [provided by RefSeq, Jul 2010].


Transcript Variant: This variant (3) differs in the 5' UTR and coding sequence compared to variant 1. The resulting isoform (3) has a shorter and distinct N-terminus compared to isoform 1.

RefSeq NP_001180400.1
CDS 404..2611
Misc Feature(1)209..211
Misc Feature(2)533..>700
Misc Feature(3)533..>700
Misc Feature(4)716..1396
Misc Feature(5)order(848..850,1115..1123,1127..1129,1145..1156,
Misc Feature(6)order(986..988,1127..1129)
Misc Feature(7)1064..>1720
Misc Feature(8)order(1172..1177,1181..1183,1187..1189)
Misc Feature(9)1400..2143
Misc Feature(10)order(1460..1465,1469..1471,1601..1603,1664..1669,
Misc Feature(11)order(1487..1489,1517..1519,1628..1633,1637..1642,
Misc Feature(12)order(1487..1489,1517..1519,1628..1633,1715..1717,
Misc Feature(13)2234..2605
Exon (1)1..379
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (2)380..476
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (3)477..582
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (4)583..769
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (5)770..871
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (6)872..997
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (7)998..1184
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (8)1185..1278
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (9)1279..1377
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (10)1378..1463
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (11)1464..1583
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (12)1584..1666
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (13)1667..1730
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (14)1731..1798
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (15)1799..1890
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (16)1891..1981
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (17)1982..2246
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (18)2247..2328
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (19)2329..2421
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (20)2422..2732
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Translation MTAGSSYPLFLAAYACTGCLAERLGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLY NFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDG NEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKIN CSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQR GNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPP DSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILG GHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWA EENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYE SWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSV YETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSIS MKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAF IDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA AFTVQAAAETLSEVA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(80)-dbSNP:
complement(80)-c, adbSNP:73473180
complement(271)-g, adbSNP:181802264
complement(275..277)-, gaadbSNP:200069827
complement(404)-g, adbSNP:2860572
complement(419)-t, cdbSNP:138010555
complement(493)-dbSNP:
complement(493)-g, adbSNP:146574307
complement(581)-t, cdbSNP:202676
complement(662)-dbSNP:
complement(662)-g, cdbSNP:139621327
complement(685)-t, cdbSNP:146289798
complement(691)-t, adbSNP:202680
complement(753)-t, cdbSNP:7128652
complement(777)-dbSNP:
complement(777)-t, cdbSNP:144409953
complement(781)-t, cdbSNP:199532174
complement(802..803)-, tdbSNP:34540261
complement(822)-g, adbSNP:137879711
complement(836)-g, cdbSNP:138510346
complement(874)-dbSNP:
complement(874)-g, adbSNP:79155991
complement(895)-g, adbSNP:75655145
complement(926)-g, adbSNP:75940285
complement(927)-t, cdbSNP:138028811
complement(1013)-dbSNP:
complement(1013)-g, cdbSNP:146923992
complement(1090)-t, cdbSNP:182169
complement(1107)-t, cdbSNP:200342475
complement(1121)-g, adbSNP:201789325
complement(1160)-g, adbSNP:140123322
complement(1189)-dbSNP:
complement(1189)-g, adbSNP:76509850
complement(1200)-t, cdbSNP:116795343
complement(1218)-t, gdbSNP:199756411
complement(1247)-t, cdbSNP:199782232
complement(1258)-g, adbSNP:143206032
complement(1282)-dbSNP:
complement(1282)-t, gdbSNP:149084901
complement(1296)-g, adbSNP:146472302
complement(1319)-t, cdbSNP:143707827
complement(1334)-t, cdbSNP:2851557
complement(1336)-g, cdbSNP:149023247
complement(1358)-t, cdbSNP:200257783
complement(1372)-g, adbSNP:144950409
complement(1417)-dbSNP:
complement(1417)-t, cdbSNP:202716
complement(1451)-t, cdbSNP:140577100
complement(1471)-dbSNP:
complement(1471)-g, adbSNP:146822849
complement(1491)-t, cdbSNP:199982130
complement(1504)-t, cdbSNP:201886725
complement(1627)-dbSNP:
complement(1627)-t, gdbSNP:149765617
complement(1735)-dbSNP:
complement(1735)-g, cdbSNP:201724751
complement(1761)-g, adbSNP:139716793
complement(1781)-g, adbSNP:61886492
complement(1827)-dbSNP:
complement(1827)-t, cdbSNP:142952497
complement(1904)-dbSNP:
complement(1904)-t, cdbSNP:140204056
complement(1999)-dbSNP:
complement(1999)-g, adbSNP:182388588
complement(2000)-t, cdbSNP:199709866
complement(2179)-g, adbSNP:147500653
complement(2216)-t, gdbSNP:143235150
complement(2251)-dbSNP:
complement(2251)-t, cdbSNP:137991256
complement(2299)-g, adbSNP:199517010
complement(2317)-g, adbSNP:144512496
complement(2438)-dbSNP:
complement(2438)-t, gdbSNP:200462865
complement(2445)-t, cdbSNP:149242168
complement(2448)-t, cdbSNP:112972107
complement(2503)-g, adbSNP:201855858
complement(2508)-t, cdbSNP:138414484
complement(2509)-t, gdbSNP:150088430
complement(2539)-t, adbSNP:1803128
complement(2556)-c, adbSNP:1803127
complement(2568)-t, adbSNP:140860006
complement(2619)-g, adbSNP:595139
complement(2689)-g, adbSNP:186975068
Gene SymbolFOLH1
Gene SynonymFGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Chromosome11
Locus Map11p11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001014986 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, mRNA. On-demand $849.00 20
NM_001193471 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, mRNA. On-demand $849.00 20
NM_001193472 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4, mRNA. On-demand $849.00 20
NM_001193473 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5, mRNA. On-demand $699.00 18
NM_004476 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, mRNA. On-demand $849.00 20
Title Association of glutamate carboxypeptidase II (GCPII) haplotypes with breast and prostate cancer risk .
Author Divyya,S., Naushad,S.M., Addlagatta,A., Murthy,P.V., Reddy,Ch.R., Digumarti,R.R., Gottumukkala,S.R., Subbarao,S.A. and Kutala,V.K.
Journal Gene 516 (1), 76-81 (2013)
Title Prolonged androgen deprivation leads to downregulation of androgen receptor and prostate-specific membrane antigen in prostate cancer cells .
Author Liu,T., Wu,L.Y., Fulton,M.D., Johnson,J.M. and Berkman,C.E.
Journal Int. J. Oncol. 41 (6), 2087-2092 (2012)
Title Glutamate carboxypeptidase II (GCPII) genetic variants as determinants of hyperhomocysteinemia: implications in stroke susceptibility .
Author Divyya,S., Naushad,S.M., Kaul,S., Anusha,V., Subbarao,S.A. and Kutala,V.K.
Journal Indian J. Biochem. Biophys. 49 (5), 356-362 (2012)
Title Prostate-specific membrane antigen and its truncated form PSM' .
Author Mlcochova,P., Barinka,C., Tykvart,J., Sacha,P. and Konvalinka,J.
Journal Prostate 69 (5), 471-479 (2009)
Title Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase .
Author Davis,M.I., Bennett,M.J., Thomas,L.M. and Bjorkman,P.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 102 (17), 5981-5986 (2005)
Title Isolation and expression of novel human glutamate carboxypeptidases with N-acetylated alpha-linked acidic dipeptidase and dipeptidyl peptidase IV activity .
Author Pangalos,M.N., Neefs,J.M., Somers,M., Verhasselt,P., Bekkers,M., van der Helm,L., Fraiponts,E., Ashton,D. and Gordon,R.D.
Journal J. Biol. Chem. 274 (13), 8470-8483 (1999)
Title Detection and characterization of the prostate-specific membrane antigen (PSMA) in tissue extracts and body fluids .
Author Troyer,J.K., Beckett,M.L. and Wright,G.L. Jr.
Journal Int. J. Cancer 62 (5), 552-558 (1995)
Title Alternatively spliced variants of prostate-specific membrane antigen RNA: ratio of expression as a potential measurement of progression .
Author Su,S.L., Huang,I.P., Fair,W.R., Powell,C.T. and Heston,W.D.
Journal Cancer Res. 55 (7), 1441-1443 (1995)
Title Expression of the prostate-specific membrane antigen .
Author Israeli,R.S., Powell,C.T., Corr,J.G., Fair,W.R. and Heston,W.D.
Journal Cancer Res. 54 (7), 1807-1811 (1994)
Title Molecular cloning of a complementary DNA encoding a prostate-specific membrane antigen .
Author Israeli,R.S., Powell,C.T., Fair,W.R. and Heston,W.D.
Journal Cancer Res. 53 (2), 227-230 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.