• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001193471 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_001193471.1, 301500667
Length 2737 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, mRNA.
Product glutamate carboxypeptidase 2 isoform 3
Comment

Summary: This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms. [provided by RefSeq, Jul 2010].


Transcript Variant: This variant (3) differs in the 5' UTR and coding sequence compared to variant 1. The resulting isoform (3) has a shorter and distinct N-terminus compared to isoform 1.

RefSeq NP_001180400.1
CDS 404..2611
Misc Feature(1)209..211
Misc Feature(2)530..>700
Misc Feature(3)530..>700
Misc Feature(4)716..1396
Misc Feature(5)order(848..850,1115..1123,1127..1129,1145..1156,
Misc Feature(6)order(986..988,1127..1129)
Misc Feature(7)order(1172..1177,1181..1183,1187..1189)
Misc Feature(8)1400..2143
Misc Feature(9)order(1460..1465,1469..1471,1601..1603,1664..1669,
Misc Feature(10)order(1487..1489,1517..1519,1628..1633,1637..1642,
Misc Feature(11)order(1487..1489,1517..1519,1628..1633,1715..1717,
Misc Feature(12)2234..2605
Exon (1)1..379
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (2)380..476
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (3)477..582
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (4)583..769
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (5)770..871
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (6)872..997
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (7)998..1184
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (8)1185..1278
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (9)1279..1377
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (10)1378..1463
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (11)1464..1583
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (12)1584..1666
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (13)1667..1730
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (14)1731..1798
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (15)1799..1890
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (16)1891..1981
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (17)1982..2246
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (18)2247..2328
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (19)2329..2421
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Exon (20)2422..2732
Gene:FOLH1
Gene Synonym:FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Translation MTAGSSYPLFLAAYACTGCLAERLGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLY NFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDG NEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKIN CSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQR GNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPP DSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILG GHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWA EENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYE SWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSV YETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSIS MKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAF IDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA AFTVQAAAETLSEVA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(80)-dbSNP:
complement(80)-c, adbSNP:73473180
complement(217)-g, adbSNP:368802471
complement(271)-g, adbSNP:181802264
complement(274..276)-, aagdbSNP:369788403
complement(275..277)-, gaadbSNP:200069827
404+a, gdbSNP:2860572
419+c, tdbSNP:138010555
complement(493)-dbSNP:
complement(493)-g, adbSNP:146574307
complement(550)-t, cdbSNP:372054306
complement(568)-t, gdbSNP:368001797
581+c, tdbSNP:202676
complement(599)-dbSNP:
complement(599)-t, gdbSNP:367766463
complement(662)-g, cdbSNP:139621327
complement(685)-t, cdbSNP:146289798
691+a, tdbSNP:202680
complement(720)-t, cdbSNP:369440863
complement(740)-t, cdbSNP:377142674
complement(753)-t, cdbSNP:7128652
complement(761)-t, cdbSNP:267602927
complement(777)-dbSNP:
complement(777)-t, cdbSNP:144409953
complement(778)-t, gdbSNP:375439459
complement(781)-t, cdbSNP:199532174
complement(801)-g, adbSNP:371189186
complement(802..803)-, tdbSNP:34540261
complement(822)-g, adbSNP:137879711
complement(823)-t, cdbSNP:377754089
complement(836)-g, cdbSNP:138510346
complement(861)-t, cdbSNP:267602926
complement(874)-dbSNP:
complement(874)-g, adbSNP:79155991
complement(895)-g, adbSNP:75655145
complement(899)-g, adbSNP:377095633
complement(926)-g, adbSNP:75940285
complement(927)-t, cdbSNP:138028811
complement(974)-t, cdbSNP:397834560
complement(1013)-dbSNP:
complement(1013)-g, cdbSNP:146923992
complement(1081)-g, adbSNP:369820383
1090+c, tdbSNP:182169
complement(1107)-t, cdbSNP:200342475
complement(1121)-g, adbSNP:201789325
complement(1122)-t, cdbSNP:375565491
complement(1160)-g, adbSNP:140123322
complement(1172)-t, adbSNP:371790405
complement(1189)-dbSNP:
complement(1189)-g, adbSNP:76509850
complement(1200)-t, cdbSNP:116795343
complement(1218)-t, gdbSNP:199756411
complement(1247)-t, cdbSNP:199782232
complement(1252)-t, cdbSNP:370918056
complement(1258)-g, adbSNP:143206032
complement(1282)-dbSNP:
complement(1282)-t, gdbSNP:149084901
complement(1296)-g, adbSNP:146472302
complement(1319)-t, cdbSNP:143707827
1334+c, tdbSNP:2851557
complement(1336)-g, cdbSNP:149023247
complement(1358)-t, cdbSNP:200257783
complement(1372)-g, adbSNP:144950409
complement(1417)-dbSNP:
complement(1417)-t, cdbSNP:202716
complement(1436)-t, cdbSNP:376770386
complement(1451)-t, cdbSNP:140577100
complement(1453)-t, cdbSNP:375313419
complement(1471)-dbSNP:
complement(1471)-g, adbSNP:146822849
complement(1491)-t, cdbSNP:199982130
complement(1504)-t, cdbSNP:201886725
complement(1627)-dbSNP:
complement(1627)-t, gdbSNP:149765617
complement(1647)-t, cdbSNP:370887055
complement(1697)-dbSNP:
complement(1697)-t, cdbSNP:375484734
complement(1735)-dbSNP:
complement(1735)-g, cdbSNP:201724751
complement(1761)-g, adbSNP:139716793
complement(1762)-t, cdbSNP:370741711
complement(1781)-g, adbSNP:61886492
complement(1827)-dbSNP:
complement(1827)-t, cdbSNP:142952497
complement(1904)-dbSNP:
complement(1904)-t, cdbSNP:140204056
complement(1916)-t, cdbSNP:267602925
complement(1937)-g, adbSNP:372239425
complement(1964)-g, adbSNP:368939818
complement(1999)-dbSNP:
complement(1999)-g, adbSNP:182388588
complement(2000)-t, cdbSNP:199709866
complement(2179)-g, adbSNP:147500653
complement(2216)-t, gdbSNP:143235150
complement(2235)-t, cdbSNP:375836358
complement(2251)-dbSNP:
complement(2251)-t, cdbSNP:137991256
complement(2299)-g, adbSNP:199517010
complement(2317)-g, adbSNP:144512496
complement(2331)-dbSNP:
complement(2331)-g, adbSNP:375948834
complement(2344)-t, cdbSNP:372016808
complement(2362)-g, cdbSNP:372600008
complement(2396)-t, cdbSNP:371048605
complement(2410)-t, cdbSNP:373131146
complement(2438)-dbSNP:
complement(2438)-t, gdbSNP:200462865
complement(2445)-t, cdbSNP:149242168
complement(2448)-t, cdbSNP:112972107
complement(2459)-c, adbSNP:368721018
complement(2503)-g, adbSNP:201855858
complement(2509)-t, gdbSNP:150088430
2539+a, tdbSNP:1803128
2556+a, cdbSNP:1803127
complement(2568)-t, adbSNP:140860006
complement(2619)-g, adbSNP:595139
complement(2631)-g, adbSNP:374114868
complement(2646)-g, adbSNP:371921219
complement(2689)-g, adbSNP:186975068
Gene SymbolFOLH1
Gene SynonymFGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
Chromosome11
Locus Map11p11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004476 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 1, mRNA. On-demand $849.00 20
NM_001014986 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 2, mRNA. On-demand $849.00 20
NM_001193473 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 5, mRNA. On-demand $699.00 18
NM_001193472 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 4, mRNA. On-demand $849.00 20
NM_001193471 Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant 3, mRNA. On-demand $849.00 20
XM_005252839 PREDICTED: Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 (FOLH1), transcript variant X1, mRNA. On-demand $849.00 20
Title Detection of pelvic lymph node micrometastasis by real-time reverse transcriptase polymerase chain reaction in prostate cancer patients after hormonal therapy .
Author Liu DY, Xia WM, Tang Q, Wang J, Wang MW, Wang Y, Wang SJ, Ye YF, Zhou WL and Shao Y.
Journal J. Cancer Res. Clin. Oncol. 140 (2), 235-241 (2014)
Title PSMA/PSA ratio evaluated by immunohistochemistry may improve diagnosis of prostate cancer .
Author Jemaa AB, Bouraoui Y, Sallami S, Banasr A, Nouira Y and Oueslati R.
Journal J Immunoassay Immunochem 35 (1), 48-59 (2014)
Title Preparation of asymmetric urea derivatives that target prostate-specific membrane antigen for SPECT imaging .
Author Harada N, Kimura H, Ono M and Saji H.
Journal J. Med. Chem. 56 (20), 7890-7901 (2013)
Title Prostate-specific membrane antigen and its truncated form PSM' .
Author Mlcochova P, Barinka C, Tykvart J, Sacha P and Konvalinka J.
Journal Prostate 69 (5), 471-479 (2009)
Title Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase .
Author Davis MI, Bennett MJ, Thomas LM and Bjorkman PJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 102 (17), 5981-5986 (2005)
Title Isolation and expression of novel human glutamate carboxypeptidases with N-acetylated alpha-linked acidic dipeptidase and dipeptidyl peptidase IV activity .
Author Pangalos MN, Neefs JM, Somers M, Verhasselt P, Bekkers M, van der Helm L, Fraiponts E, Ashton D and Gordon RD.
Journal J. Biol. Chem. 274 (13), 8470-8483 (1999)
Title Detection and characterization of the prostate-specific membrane antigen (PSMA) in tissue extracts and body fluids .
Author Troyer JK, Beckett ML and Wright GL Jr.
Journal Int. J. Cancer 62 (5), 552-558 (1995)
Title Alternatively spliced variants of prostate-specific membrane antigen RNA: ratio of expression as a potential measurement of progression .
Author Su SL, Huang IP, Fair WR, Powell CT and Heston WD.
Journal Cancer Res. 55 (7), 1441-1443 (1995)
Title Expression of the prostate-specific membrane antigen .
Author Israeli RS, Powell CT, Corr JG, Fair WR and Heston WD.
Journal Cancer Res. 54 (7), 1807-1811 (1994)
Title Molecular cloning of a complementary DNA encoding a prostate-specific membrane antigen .
Author Israeli RS, Powell CT, Fair WR and Heston WD.
Journal Cancer Res. 53 (2), 227-230 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.