• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. GenEZ ORF Cloning On-demand $299.00 14

*Business Day

Related Services

RefSeq Version NM_001195260.1, 305410863
Length 975 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA.
Product myomegalin isoform 6
Comment

Summary: The protein encoded by this gene serves to anchor phosphodiesterase 4D to the Golgi/centrosome region of the cell. Defects in this gene may be a cause of myeloproliferative disorder (MBD) associated with eosinophilia. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2010].


Transcript Variant: This variant (6) differs in both UTRs and in the coding sequence compared to variant 1. The resulting isoform (6) is shorter at the N- and C-termini compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## CDS exon combination :: DT220587.1 [ECO:0000331] RNAseq introns :: mixed/partial sample support ERS025084, ERS025088 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001182189.1
CDS 96..521
Misc Feature(1)<96..230
Misc Feature(2)<96..230
Exon (1)1..29
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Exon (2)30..140
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Exon (3)141..217
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Exon (4)218..341
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Exon (5)342..957
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Translation MQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFE ERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWE DVPGDQVKPDQYTEALAQRDK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(10)-dbSNP:
complement(10)-g, adbSNP:12047107
complement(13)-t, cdbSNP:57072272
complement(19)-t, cdbSNP:3845317
complement(37)-dbSNP:
complement(37)-t, cdbSNP:3010980
complement(61)-c, adbSNP:146993928
complement(73)-c, adbSNP:1664022
complement(77)-g, adbSNP:147804991
complement(108)-g, adbSNP:149688356
complement(120)-t, gdbSNP:142489262
complement(145)-dbSNP:
complement(145)-g, adbSNP:139573102
complement(165)-g, cdbSNP:61743332
complement(178)-t, cdbSNP:146152526
complement(180)-c, adbSNP:200292567
complement(190)-t, cdbSNP:142987550
complement(201)-g, adbSNP:146353419
complement(220)-dbSNP:
complement(220)-g, cdbSNP:200038610
complement(326)-g, cdbSNP:149078147
complement(372)-dbSNP:
complement(372)-g, adbSNP:150616778
complement(463)-g, cdbSNP:148545794
complement(498)-t, cdbSNP:139438772
complement(511)-g, adbSNP:3121544
complement(640)-c, adbSNP:71220421
complement(745)-t, cdbSNP:77471170
complement(759)-t, cdbSNP:142985095
complement(799)-g, adbSNP:200466737
complement(838)-t, adbSNP:141695068
complement(944)-g, adbSNP:2762729
Gene SymbolPDE4DIP
Gene SynonymCMYA2; MMGL
Chromosome1
Locus Map1q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001002810 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 4, mRNA. On-demand $399.00 14
NM_001002811 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 5, mRNA. On-demand $1699.00 25
NM_001002812 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 2, mRNA. On-demand $899.00 20
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $299.00 14
NM_001195261 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 7, mRNA. On-demand $399.00 14
NM_001198832 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 8, mRNA. On-demand $3749.00 35
NM_001198834 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 9, mRNA. On-demand $3749.00 35
NM_014644 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 1, mRNA. On-demand $3749.00 35
NM_022359 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 3, mRNA. On-demand $449.00 14
Title Identification of novel germline polymorphisms governing capecitabine sensitivity .
Author O'Donnell,P.H., Stark,A.L., Gamazon,E.R., Wheeler,H.E., McIlwee,B.E., Gorsic,L., Im,H.K., Huang,R.S., Cox,N.J. and Dolan,M.E.
Journal Cancer 118 (16), 4063-4073 (2012)
Title Direct interaction of the Usher syndrome 1G protein SANS and myomegalin in the retina .
Author Overlack,N., Kilic,D., Bauss,K., Marker,T., Kremer,H., van Wijk,E. and Wolfrum,U.
Journal Biochim. Biophys. Acta 1813 (10), 1883-1892 (2011)
Title Protein microarray analysis identifies human cellular prion protein interactors .
Author Satoh,J., Obayashi,S., Misawa,T., Sumiyoshi,K., Oosumi,K. and Tabunoki,H.
Journal Neuropathol. Appl. Neurobiol. 35 (1), 16-35 (2009)
Title Protein kinase A, Ca2+/calmodulin-dependent kinase II, and calcineurin regulate the intracellular trafficking of myopodin between the Z-disc and the nucleus of cardiac myocytes .
Author Faul,C., Dhume,A., Schecter,A.D. and Mundel,P.
Journal Mol. Cell. Biol. 27 (23), 8215-8227 (2007)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M.
Journal Genomics 89 (3), 307-315 (2007)
Title Serum anti-myomegalin antibodies in patients with esophageal squamous cell carcinoma .
Author Shimada,H., Kuboshima,M., Shiratori,T., Nabeya,Y., Takeuchi,A., Takagi,H., Nomura,F., Takiguchi,M., Ochiai,T. and Hiwasa,T.
Journal Int. J. Oncol. 30 (1), 97-103 (2007)
Title A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration .
Author Lim,J., Hao,T., Shaw,C., Patel,A.J., Szabo,G., Rual,J.F., Fisk,C.J., Li,N., Smolyar,A., Hill,D.E., Barabasi,A.L., Vidal,M. and Zoghbi,H.Y.
Journal Cell 125 (4), 801-814 (2006)
Title Isolation of novel heart-specific genes using the BodyMap database .
Author Soejima,H., Kawamoto,S., Akai,J., Miyoshi,O., Arai,Y., Morohka,T., Matsuo,S., Niikawa,N., Kimura,A., Okubo,K. and Mukai,T.
Journal Genomics 74 (1), 115-120 (2001)
Title Myomegalin is a novel protein of the golgi/centrosome that interacts with a cyclic nucleotide phosphodiesterase .
Author Verde,I., Pahlke,G., Salanova,M., Zhang,G., Wang,S., Coletti,D., Onuffer,J., Jin,S.L. and Conti,M.
Journal J. Biol. Chem. 276 (14), 11189-11198 (2001)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.