• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu01669 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu01669C Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001195260.1, 305410863
Length 426 bp
Structure linear
Update Date 20-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA.
Product myomegalin isoform 6
Comment

Summary: The protein encoded by this gene serves to anchor phosphodiesterase 4D to the Golgi/centrosome region of the cell. Defects in this gene may be a cause of myeloproliferative disorder (MBD) associated with eosinophilia. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2010].


Transcript Variant: This variant (6) differs in both UTRs and in the coding sequence compared to variant 1. The resulting isoform (6) is shorter at the N- and C-termini compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## CDS exon combination :: DT220587.1, BF576325.1 [ECO:0000331] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001182189.1
CDS 96..521
Misc Feature(1)<96..230
Misc Feature(2)<96..230
Exon (1)1..29
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Exon (2)30..140
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Exon (3)141..217
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Exon (4)218..341
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Exon (5)342..957
Gene:PDE4DIP
Gene Synonym:CMYA2; MMGL
Translation MQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFE ERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWE DVPGDQVKPDQYTEALAQRDK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(10)-dbSNP:
complement(10)-g, adbSNP:12047107
complement(13)-t, cdbSNP:57072272
complement(19)-t, cdbSNP:3845317
complement(20)-t, cdbSNP:368628246
complement(37)-dbSNP:
complement(37)-t, cdbSNP:3010980
complement(61)-c, adbSNP:146993928
complement(73)-c, adbSNP:1664022
complement(77)-g, adbSNP:147804991
complement(94)-t, cdbSNP:372978033
complement(120)-t, gdbSNP:142489262
complement(121)-t, cdbSNP:373829403
complement(145)-dbSNP:
complement(145)-g, adbSNP:139573102
complement(165)-g, cdbSNP:61743332
complement(178)-t, cdbSNP:146152526
complement(180)-c, adbSNP:200292567
complement(190)-t, cdbSNP:142987550
complement(201)-g, adbSNP:146353419
complement(220)-dbSNP:
complement(220)-g, cdbSNP:200038610
complement(326)-g, cdbSNP:149078147
complement(338)-c, adbSNP:376741952
complement(370)-dbSNP:
complement(370)-g, adbSNP:375914249
complement(372)-g, adbSNP:150616778
complement(399..401)-, cttdbSNP:376850767
complement(417)-g, adbSNP:371252645
complement(463)-g, cdbSNP:148545794
complement(489)-g, adbSNP:367808124
complement(498)-t, cdbSNP:139438772
complement(498)-g, adbSNP:2590120
511+a, gdbSNP:3121544
complement(551)-g, adbSNP:370106363
complement(640)-c, adbSNP:71220421
complement(686)-t, adbSNP:2258467
complement(715)-t, cdbSNP:373048093
complement(718)-c, adbSNP:368076114
complement(745)-t, cdbSNP:77471170
complement(759)-t, cdbSNP:142985095
complement(799)-g, adbSNP:200466737
complement(838)-t, adbSNP:141695068
944+a, gdbSNP:2762729
Gene SymbolPDE4DIP
Gene SynonymCMYA2; MMGL
Chromosome1
Locus Map1q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
NM_001195260 Homo sapiens phosphodiesterase 4D interacting protein (PDE4DIP), transcript variant 6, mRNA. On-demand $159.00 7-9
Title Identification of novel germline polymorphisms governing capecitabine sensitivity .
Author O'Donnell PH, Stark AL, Gamazon ER, Wheeler HE, McIlwee BE, Gorsic L, Im HK, Huang RS, Cox NJ and Dolan ME.
Journal Cancer 118 (16), 4063-4073 (2012)
Title Direct interaction of the Usher syndrome 1G protein SANS and myomegalin in the retina .
Author Overlack N, Kilic D, Bauss K, Marker T, Kremer H, van Wijk E and Wolfrum U.
Journal Biochim. Biophys. Acta 1813 (10), 1883-1892 (2011)
Title Protein microarray analysis identifies human cellular prion protein interactors .
Author Satoh J, Obayashi S, Misawa T, Sumiyoshi K, Oosumi K and Tabunoki H.
Journal Neuropathol. Appl. Neurobiol. 35 (1), 16-35 (2009)
Title Protein kinase A, Ca2+/calmodulin-dependent kinase II, and calcineurin regulate the intracellular trafficking of myopodin between the Z-disc and the nucleus of cardiac myocytes .
Author Faul C, Dhume A, Schecter AD and Mundel P.
Journal Mol. Cell. Biol. 27 (23), 8215-8227 (2007)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch P, Li N, Milstein S, Fan C, Hao T, Szabo G, Hu Z, Venkatesan K, Bethel G, Martin P, Rogers J, Lawlor S, McLaren S, Dricot A, Borick H, Cusick ME, Vandenhaute J, Dunham I, Hill DE and Vidal M.
Journal Genomics 89 (3), 307-315 (2007)
Title Serum anti-myomegalin antibodies in patients with esophageal squamous cell carcinoma .
Author Shimada H, Kuboshima M, Shiratori T, Nabeya Y, Takeuchi A, Takagi H, Nomura F, Takiguchi M, Ochiai T and Hiwasa T.
Journal Int. J. Oncol. 30 (1), 97-103 (2007)
Title A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration .
Author Lim J, Hao T, Shaw C, Patel AJ, Szabo G, Rual JF, Fisk CJ, Li N, Smolyar A, Hill DE, Barabasi AL, Vidal M and Zoghbi HY.
Journal Cell 125 (4), 801-814 (2006)
Title Isolation of novel heart-specific genes using the BodyMap database .
Author Soejima H, Kawamoto S, Akai J, Miyoshi O, Arai Y, Morohka T, Matsuo S, Niikawa N, Kimura A, Okubo K and Mukai T.
Journal Genomics 74 (1), 115-120 (2001)
Title Myomegalin is a novel protein of the golgi/centrosome that interacts with a cyclic nucleotide phosphodiesterase .
Author Verde I, Pahlke G, Salanova M, Zhang G, Wang S, Coletti D, Onuffer J, Jin SL and Conti M.
Journal J. Biol. Chem. 276 (14), 11189-11198 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.