• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001195684 Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_001195684.1, 307574633
Length 6308 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 3, mRNA.
Product transforming growth factor beta receptor type 3 isoform b
Comment

Summary: This locus encodes the transforming growth factor (TGF)-beta type III receptor. The encoded receptor is a membrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. Ectodomain shedding produces soluble TGFBR3, which may inhibit TGFB signaling. Decreased expression of this receptor has been observed in various cancers. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.[provided by RefSeq, Sep 2010].


Transcript Variant: This variant (3) differs in the 5' UTR and uses an alternate in-frame splice site in the middle portion of the coding region, compared to variant 1. This results in a shorter protein (isoform b), compared to isoform a. Both variants 2 and 3 encode the same isoform (b).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001182613.1
CDS 352..2904
Misc Feature(1)313..315
Misc Feature(2)1711..2523
Misc Feature(3)1711..2523
Misc Feature(4)2710..2775
Exon (1)1..177
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (2)178..238
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (3)239..412
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (4)413..597
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (5)598..735
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (6)736..919
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (7)920..1088
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (8)1089..1236
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (9)1237..1426
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (10)1427..1761
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (11)1762..1914
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (12)1915..2055
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (13)2056..2214
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (14)2215..2514
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (15)2515..2635
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (16)2636..2677
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (17)2678..2785
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (18)2786..6300
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Translation MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGL PQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLA TGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIA RNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITP NSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSI GFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNEE MGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGL PRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVT LLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYE DLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTD LFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICP KDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLP KCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHG LDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGSTQ STPCSSSSTA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(101)-dbSNP:
complement(101)-t, adbSNP:17881050
complement(114)-g, adbSNP:17882736
complement(117)-g, adbSNP:11466548
complement(152)-t, cdbSNP:75198223
complement(154)-t, cdbSNP:76356150
complement(259)-dbSNP:
complement(259)-t, cdbSNP:181487368
complement(314)-g, adbSNP:1805109
complement(362)-t, cdbSNP:189150159
complement(366)-g, adbSNP:201318720
complement(392)-g, adbSNP:17884205
complement(395)-t, cdbSNP:1805110
complement(406)-t, cdbSNP:147586574
complement(436)-dbSNP:
complement(436)-g, cdbSNP:150762460
complement(504)-g, adbSNP:199845905
complement(547)-t, cdbSNP:181868200
complement(566)-g, adbSNP:148678001
complement(567..569)-g, adbSNP:1805111
complement(567)-g, c, adbSNP:2810904
complement(672)-dbSNP:
complement(672)-t, gdbSNP:202175419
complement(706)-g, adbSNP:146325720
complement(720)-t, cdbSNP:17881905
complement(771)-dbSNP:
complement(771)-t, cdbSNP:150238777
complement(775)-t, cdbSNP:61748116
complement(777)-g, adbSNP:201647804
complement(804)-g, adbSNP:17883665
complement(815)-t, cdbSNP:41286789
complement(839)-t, gdbSNP:17885124
complement(845)-t, cdbSNP:148843052
complement(856)-t, cdbSNP:190581409
complement(863)-g, adbSNP:186259544
complement(870)-t, cdbSNP:2306888
complement(939)-dbSNP:
complement(939)-g, adbSNP:11466585
complement(969)-g, adbSNP:141981218
complement(1022)-g, adbSNP:150076618
complement(1032)-t, cdbSNP:17879403
complement(1056)-g, adbSNP:191275535
complement(1069)-g, adbSNP:188060482
complement(1156)-dbSNP:
complement(1156)-g, adbSNP:147108633
complement(1167)-g, adbSNP:183798036
complement(1235)-g, adbSNP:146918650
complement(1237)-dbSNP:
complement(1237)-c, adbSNP:140100898
complement(1286)-g, adbSNP:149079126
complement(1297)-t, cdbSNP:144104234
complement(1358)-t, cdbSNP:200531720
complement(1395)-c, adbSNP:200330964
complement(1402)-t, adbSNP:11466592
complement(1411)-g, adbSNP:41305630
complement(1412)-t, cdbSNP:202193233
complement(1476)-dbSNP:
complement(1476)-t, cdbSNP:11466595
complement(1554)-g, adbSNP:1805112
complement(1563)-g, cdbSNP:200104902
complement(1580)-t, cdbSNP:145694501
complement(1616)-t, cdbSNP:201034517
complement(1652)-g, adbSNP:118059179
complement(1675)-g, cdbSNP:149771979
complement(1689)-t, cdbSNP:2229500
complement(1690)-t, cdbSNP:139306280
complement(1712)-t, adbSNP:146915187
complement(1724)-t, cdbSNP:188034157
complement(1817)-dbSNP:
complement(1817)-t, cdbSNP:138396794
complement(1856)-t, cdbSNP:201897960
complement(1914)-g, adbSNP:183096494
complement(1947)-dbSNP:
complement(1947)-c, adbSNP:199525985
complement(1958)-g, adbSNP:140758164
complement(1968)-t, cdbSNP:61748119
complement(1999)-t, gdbSNP:150461884
complement(2050)-t, cdbSNP:201405416
complement(2085)-dbSNP:
complement(2085)-t, gdbSNP:111842248
complement(2118)-t, cdbSNP:17884575
complement(2175)-g, adbSNP:114901303
complement(2217)-dbSNP:
complement(2217)-g, adbSNP:2228362
complement(2251)-g, adbSNP:17882578
complement(2261)-g, adbSNP:148711567
complement(2368)-t, cdbSNP:139927115
complement(2375)-g, adbSNP:147485470
complement(2376)-t, cdbSNP:1805113
complement(2385)-t, cdbSNP:148167041
complement(2403)-t, cdbSNP:142025249
complement(2420)-g, adbSNP:143011025
complement(2472)-t, cdbSNP:199724223
complement(2508)-g, cdbSNP:137915935
complement(2550)-dbSNP:
complement(2550)-g, adbSNP:143550507
complement(2551)-t, cdbSNP:150162893
complement(2589)-t, cdbSNP:151016095
complement(2595)-t, cdbSNP:284878
complement(2641)-dbSNP:
complement(2641)-g, cdbSNP:17882828
complement(2677)-t, cdbSNP:2228363
complement(2694)-dbSNP:
complement(2694)-t, cdbSNP:142345668
complement(2707)-t, cdbSNP:141883791
complement(2716)-t, adbSNP:137909765
complement(2822)-dbSNP:
complement(2822)-g, adbSNP:138603096
complement(2823)-t, cdbSNP:143117141
complement(2832)-g, adbSNP:34064838
complement(2867)-t, cdbSNP:193920827
complement(2868)-g, adbSNP:17878885
complement(2876)-g, adbSNP:188809339
complement(2897)-g, adbSNP:147885293
complement(2913)-t, cdbSNP:202191737
complement(2923)-g, adbSNP:1131243
complement(3040)-t, adbSNP:199503452
complement(3061)-g, adbSNP:1805115
complement(3104)-g, adbSNP:1805116
complement(3164)-t, cdbSNP:182999308
complement(3189)-t, adbSNP:1050619
complement(3330)-g, adbSNP:192924147
complement(3361)-g, adbSNP:1805117
complement(3374)-g, adbSNP:138858788
complement(3391)-g, adbSNP:41313401
complement(3430)-t, adbSNP:1050620
complement(3474)-t, adbSNP:1050621
complement(3475)-t, adbSNP:1050623
complement(3500)-g, adbSNP:145038062
complement(3531)-t, gdbSNP:1050624
complement(3633)-t, cdbSNP:186509687
complement(3637)-g, adbSNP:182258756
complement(3780)-t, cdbSNP:190787610
complement(3865)-t, cdbSNP:186173500
complement(3912)-t, cdbSNP:149171541
complement(3949)-t, cdbSNP:145149335
complement(3964)-g, c, adbSNP:990
complement(3973)-g, cdbSNP:902
complement(4027)-t, gdbSNP:149986478
complement(4048)-t, cdbSNP:140877088
complement(4150)-t, gdbSNP:147653232
complement(4187)-g, adbSNP:1804506
complement(4211..4212)-, gdbSNP:34978889
complement(4235)-t, cdbSNP:76721579
complement(4237..4238)-, tttdbSNP:59188054
complement(4239)-, cttdbSNP:74741125
complement(4239)-t, cdbSNP:200216410
complement(4246)-, adbSNP:17883810
complement(4279)-t, gdbSNP:72714407
complement(4284)-t, cdbSNP:28394336
complement(4332)-g, adbSNP:184187810
complement(4336)-t, cdbSNP:28698523
complement(4340)-t, adbSNP:111695686
complement(4490)-t, cdbSNP:75861863
complement(4501)-t, cdbSNP:191543210
complement(4638)-t, gdbSNP:139697752
complement(4705)-g, adbSNP:74923072
complement(4732)-t, adbSNP:75692888
complement(4734)-t, adbSNP:74896573
complement(4742..4743)-, adbSNP:201044103
complement(4882)-g, cdbSNP:111911073
complement(4893)-t, gdbSNP:186980840
complement(5252)-t, cdbSNP:181125491
complement(5283)-c, adbSNP:6669888
complement(5310)-g, adbSNP:17571088
complement(5357)-t, gdbSNP:147408871
complement(5481)-g, adbSNP:188735272
complement(5529)-t, cdbSNP:55667079
complement(5570)-c, adbSNP:56404248
complement(5575)-t, cdbSNP:185197797
complement(5611)-g, cdbSNP:34364530
complement(5684)-g, adbSNP:79001261
complement(5843)-g, adbSNP:77378509
complement(5865)-g, cdbSNP:113200221
complement(5872)-g, adbSNP:116500181
complement(5921)-g, adbSNP:113820201
complement(6021)-c, adbSNP:56247486
complement(6137)-t, cdbSNP:180780531
complement(6158)-t, cdbSNP:188411829
complement(6293)-t, cdbSNP:74103025
Gene SymbolTGFBR3
Gene Synonymbetaglycan; BGCAN
Chromosome1
Locus Map1p33-p32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001195683 Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 2, mRNA. On-demand $899.00 20
NM_001195684 Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 3, mRNA. On-demand $899.00 20
NM_003243 Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 1, mRNA. On-demand $899.00 20
Title Convergent animal and human evidence suggests the activin/inhibin pathway to be involved in antidepressant response .
Author Ganea,K., Menke,A., Schmidt,M.V., Lucae,S., Rammes,G., Liebl,C., Harbich,D., Sterlemann,V., Storch,C., Uhr,M., Holsboer,F., Binder,E.B., Sillaber,I. and Muller,M.B.
Journal Transl Psychiatry 2, E177 (2012)
Title Differential regulation of Smad3 and of the type II transforming growth factor-beta receptor in mitosis: implications for signaling .
Author Hirschhorn,T., Barizilay,L., Smorodinsky,N.I. and Ehrlich,M.
Journal PLoS ONE 7 (8), E43459 (2012)
Title Granzyme B cleaves decorin, biglycan and soluble betaglycan, releasing active transforming growth factor-beta1 .
Author Boivin,W.A., Shackleford,M., Vanden Hoek,A., Zhao,H., Hackett,T.L., Knight,D.A. and Granville,D.J.
Journal PLoS ONE 7 (3), E33163 (2012)
Title Roles for the type III TGF-beta receptor in human cancer .
Author Gatza,C.E., Oh,S.Y. and Blobe,G.C.
Journal Cell. Signal. 22 (8), 1163-1174 (2010)
Title Expression of the type III TGF-beta receptor is negatively regulated by TGF-beta .
Author Hempel,N., How,T., Cooper,S.J., Green,T.R., Dong,M., Copland,J.A., Wood,C.G. and Blobe,G.C.
Journal Carcinogenesis 29 (5), 905-912 (2008)
Title Assignment of human transforming growth factor-beta type I and type .
Author Johnson,D.W., Qumsiyeh,M., Benkhalifa,M. and Marchuk,D.A.
Journal Genomics 28 (2), 356-357 (1995)
Title Molecular cloning and characterization of the human and porcine transforming growth factor-beta type III receptors .
Author Moren,A., Ichijo,H. and Miyazono,K.
Journal Biochem. Biophys. Res. Commun. 189 (1), 356-362 (1992)
Title Receptors for the TGF-beta family .
Author Massague,J.
Journal Cell 69 (7), 1067-1070 (1992)
Title Expression cloning and characterization of the TGF-beta type III receptor .
Author Wang,X.F., Lin,H.Y., Ng-Eaton,E., Downward,J., Lodish,H.F. and Weinberg,R.A.
Journal Cell 67 (4), 797-805 (1991)
Title Structure and expression of the membrane proteoglycan betaglycan, a component of the TGF-beta receptor system .
Author Lopez-Casillas,F., Cheifetz,S., Doody,J., Andres,J.L., Lane,W.S. and Massague,J.
Journal Cell 67 (4), 785-795 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.