• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu16032 Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 3, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu16032C Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 3, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001195684.1, 307574633
Length 2553 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens transforming growth factor, beta receptor III (TGFBR3), transcript variant 3, mRNA.
Product transforming growth factor beta receptor type 3 isoform b precursor
Comment

Summary: This locus encodes the transforming growth factor (TGF)-beta type III receptor. The encoded receptor is a membrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. Ectodomain shedding produces soluble TGFBR3, which may inhibit TGFB signaling. Decreased expression of this receptor has been observed in various cancers. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.[provided by RefSeq, Sep 2010].


Transcript Variant: This variant (3) differs in the 5' UTR and uses an alternate in-frame splice site in the middle portion of the coding region, compared to variant 1. This results in a shorter protein (isoform b), compared to isoform a. Both variants 2 and 3 encode the same isoform (b).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001182613.1
CDS 352..2904
Misc Feature(1)313..315
Misc Feature(2)1711..2523
Misc Feature(3)2710..2775
Exon (1)1..177
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (2)178..238
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (3)239..412
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (4)413..597
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (5)598..735
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (6)736..919
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (7)920..1088
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (8)1089..1236
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (9)1237..1426
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (10)1427..1761
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (11)1762..1914
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (12)1915..2055
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (13)2056..2214
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (14)2215..2514
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (15)2515..2635
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (16)2636..2677
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (17)2678..2785
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Exon (18)2786..6300
Gene:TGFBR3
Gene Synonym:betaglycan; BGCAN
Translation MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGL PQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLA TGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIA RNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITP NSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSI GFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNEE MGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGL PRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVT LLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYE DLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTD LFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICP KDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLP KCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHG LDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGSTQ STPCSSSSTA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(101)-dbSNP:
complement(101)-t, adbSNP:17881050
complement(114)-g, adbSNP:17882736
117+a, gdbSNP:11466548
complement(152)-t, cdbSNP:75198223
complement(154)-t, cdbSNP:76356150
complement(207)-dbSNP:
complement(207)-t, cdbSNP:374956892
complement(259)-dbSNP:
complement(259)-t, cdbSNP:181487368
complement(291)-t, gdbSNP:368069428
314+a, gdbSNP:1805109
complement(314)-t, cdbSNP:386545690
complement(326)-g, adbSNP:376626057
complement(362)-t, cdbSNP:189150159
complement(366)-g, adbSNP:201318720
complement(392)-g, adbSNP:17884205
complement(392)-g, adbSNP:386545214
complement(395)-t, cdbSNP:386545691
395+c, tdbSNP:1805110
complement(406)-t, cdbSNP:147586574
complement(436)-dbSNP:
complement(436)-g, cdbSNP:150762460
complement(447)-g, adbSNP:373417209
complement(504)-g, adbSNP:199845905
complement(547)-t, cdbSNP:181868200
complement(560)-t, cdbSNP:373327242
567..569+a, gdbSNP:1805111
567+a, c, gdbSNP:2810904
complement(672)-dbSNP:
complement(672)-t, gdbSNP:202175419
complement(706)-g, adbSNP:146325720
720+c, tdbSNP:17881905
complement(720)-g, adbSNP:386545124
complement(758)-dbSNP:
complement(758)-t, cdbSNP:375529061
complement(771)-t, cdbSNP:150238777
complement(773)-t, adbSNP:372344244
775+c, tdbSNP:61748116
complement(777)-g, adbSNP:201647804
complement(798)-t, cdbSNP:368616204
complement(804)-g, adbSNP:17883665
complement(808)-g, adbSNP:376114836
complement(815)-t, cdbSNP:41286789
839+g, tdbSNP:17885124
complement(845)-t, cdbSNP:148843052
complement(856)-t, cdbSNP:190581409
complement(863)-g, adbSNP:186259544
complement(870)-t, cdbSNP:2306888
complement(870)-g, adbSNP:386564567
complement(876)-g, adbSNP:376528004
complement(926)-dbSNP:
complement(926)-g, adbSNP:370498680
939+a, gdbSNP:11466585
complement(969)-g, adbSNP:141981218
complement(1001)-g, cdbSNP:377574327
complement(1022)-g, adbSNP:150076618
complement(1024)-t, gdbSNP:368820380
1032+c, tdbSNP:17879403
complement(1032)-g, adbSNP:386545016
complement(1054)-t, cdbSNP:373402175
complement(1056)-g, adbSNP:191275535
complement(1057)-t, cdbSNP:373881895
complement(1069)-g, adbSNP:188060482
complement(1116)-dbSNP:
complement(1116)-t, adbSNP:369086061
complement(1125)-c, adbSNP:375200304
complement(1156)-g, adbSNP:147108633
complement(1167)-g, adbSNP:183798036
complement(1235)-g, adbSNP:146918650
complement(1237)-dbSNP:
complement(1237)-c, adbSNP:140100898
complement(1286)-g, adbSNP:149079126
complement(1297)-t, cdbSNP:144104234
complement(1308)-g, cdbSNP:369559704
complement(1358)-t, cdbSNP:200531720
complement(1374)-t, gdbSNP:371359360
complement(1395)-c, adbSNP:200330964
1402+a, tdbSNP:11466592
complement(1411)-g, adbSNP:41305630
complement(1412)-t, cdbSNP:202193233
1476+dbSNP:
1476+c, tdbSNP:11466595
complement(1511)-t, adbSNP:371268765
complement(1515)-t, cdbSNP:368105520
complement(1523)-t, cdbSNP:373979895
1554+a, gdbSNP:1805112
complement(1563)-g, cdbSNP:200104902
complement(1580)-t, cdbSNP:145694501
complement(1590)-g, adbSNP:368258508
complement(1616)-t, cdbSNP:201034517
complement(1623)-t, cdbSNP:375543343
complement(1652)-g, adbSNP:118059179
complement(1675)-g, cdbSNP:149771979
1689+c, tdbSNP:2229500
complement(1690)-t, cdbSNP:139306280
complement(1712)-t, adbSNP:146915187
complement(1724)-t, cdbSNP:188034157
complement(1785)-dbSNP:
complement(1785)-g, adbSNP:369943428
complement(1786)-t, cdbSNP:375360299
complement(1817)-t, cdbSNP:138396794
complement(1856)-t, cdbSNP:201897960
complement(1877)-t, cdbSNP:373312953
complement(1914)-g, adbSNP:183096494
complement(1947)-dbSNP:
complement(1947)-c, adbSNP:199525985
complement(1958)-g, adbSNP:140758164
1968+c, tdbSNP:61748119
complement(1999)-t, gdbSNP:150461884
complement(2001)-t, cdbSNP:368651115
complement(2050)-t, cdbSNP:201405416
complement(2085)-dbSNP:
complement(2085)-t, gdbSNP:111842248
complement(2091)-g, adbSNP:369529047
complement(2112)-g, adbSNP:376531068
complement(2118)-t, cdbSNP:17884575
complement(2175)-g, adbSNP:114901303
2217+dbSNP:
2217+a, gdbSNP:2228362
2251+a, gdbSNP:17882578
complement(2251)-t, cdbSNP:386545151
complement(2261)-g, adbSNP:148711567
complement(2361)-g, adbSNP:376827122
complement(2368)-t, cdbSNP:139927115
complement(2375)-g, adbSNP:147485470
2376+c, tdbSNP:1805113
complement(2385)-t, cdbSNP:148167041
complement(2403)-t, cdbSNP:142025249
complement(2472)-t, cdbSNP:199724223
complement(2508)-g, cdbSNP:137915935
complement(2529)-dbSNP:
complement(2529)-g, adbSNP:376382556
complement(2550)-g, adbSNP:143550507
complement(2551)-t, cdbSNP:150162893
complement(2563)-t, adbSNP:377239958
complement(2569)-t, cdbSNP:367749656
complement(2588)-g, adbSNP:373781090
complement(2589)-t, cdbSNP:151016095
2595+c, tdbSNP:284878
2641+dbSNP:
2641+c, gdbSNP:17882828
complement(2677)-t, cdbSNP:2228363
complement(2694)-dbSNP:
complement(2694)-t, cdbSNP:142345668
complement(2706)-g, adbSNP:373480626
complement(2707)-t, cdbSNP:141883791
complement(2716)-t, adbSNP:137909765
complement(2790)-dbSNP:
complement(2790)-t, cdbSNP:368530249
complement(2822)-g, adbSNP:138603096
complement(2823)-t, cdbSNP:143117141
2832+a, gdbSNP:34064838
2867+c, tdbSNP:193920827
2868+a, gdbSNP:17878885
complement(2876)-g, adbSNP:188809339
complement(2897)-g, adbSNP:147885293
complement(2913)-t, cdbSNP:202191737
complement(2919)-t, cdbSNP:375168931
complement(2921)-g, cdbSNP:371085991
2923+a, gdbSNP:1131243
complement(3040)-t, adbSNP:199503452
3061+a, gdbSNP:1805115
3104+a, gdbSNP:1805116
complement(3159)-g, adbSNP:375927498
complement(3164)-t, cdbSNP:182999308
3189+a, tdbSNP:1050619
complement(3330)-g, adbSNP:192924147
3361+a, gdbSNP:1805117
complement(3374)-g, adbSNP:138858788
complement(3391)-g, adbSNP:41313401
3430+a, tdbSNP:1050620
3474+a, tdbSNP:1050621
3475+a, tdbSNP:1050623
complement(3500)-g, adbSNP:145038062
3531+g, tdbSNP:1050624
complement(3633)-t, cdbSNP:186509687
complement(3637)-g, adbSNP:182258756
complement(3694)-t, cdbSNP:374704929
complement(3780)-t, cdbSNP:190787610
complement(3786)-t, cdbSNP:374069443
complement(3865)-t, cdbSNP:186173500
complement(3912)-t, cdbSNP:149171541
complement(3949)-t, cdbSNP:145149335
3964+a, c, gdbSNP:990
3973+c, gdbSNP:902
complement(4027)-t, gdbSNP:149986478
complement(4048)-t, cdbSNP:140877088
complement(4150)-t, gdbSNP:147653232
4187+a, gdbSNP:1804506
complement(4210..4211)-, gdbSNP:34978889
complement(4217..4218)-, tttdbSNP:59188054
complement(4218)-t, adbSNP:368181429
complement(4235)-t, cdbSNP:76721579
complement(4239)-t, cdbSNP:200216410
4246+, adbSNP:17883810
complement(4279)-t, gdbSNP:72714407
complement(4284)-t, cdbSNP:28394336
complement(4332)-g, adbSNP:184187810
complement(4336)-t, cdbSNP:28698523
complement(4340)-t, adbSNP:111695686
complement(4490)-t, cdbSNP:75861863
complement(4501)-t, cdbSNP:191543210
complement(4567)-g, adbSNP:375232472
complement(4572)-t, cdbSNP:370676839
complement(4606)-t, cdbSNP:368850678
complement(4638)-t, gdbSNP:139697752
complement(4705)-g, adbSNP:74923072
complement(4732)-t, adbSNP:75692888
complement(4734)-t, adbSNP:74896573
complement(4742..4743)-, adbSNP:201044103
complement(4817)-g, adbSNP:376306385
complement(4882)-g, cdbSNP:111911073
complement(4893)-t, gdbSNP:186980840
complement(5048)-g, adbSNP:371215513
complement(5165)-c, adbSNP:377444926
complement(5225)-t, adbSNP:373115808
complement(5244..5247)-, ctctdbSNP:370192616
complement(5249)-t, cdbSNP:376113740
complement(5252)-t, cdbSNP:181125491
complement(5283)-c, adbSNP:6669888
complement(5310)-g, adbSNP:17571088
complement(5357)-t, gdbSNP:147408871
complement(5476)-g, cdbSNP:373652155
complement(5481)-g, adbSNP:188735272
complement(5529)-t, cdbSNP:55667079
complement(5570)-c, adbSNP:56404248
complement(5575)-t, cdbSNP:185197797
complement(5611)-g, cdbSNP:34364530
complement(5684)-t, cdbSNP:386440067
complement(5684)-g, adbSNP:79001261
complement(5777)-, tdbSNP:376911402
complement(5843)-g, adbSNP:77378509
complement(5865)-g, cdbSNP:113200221
complement(5872)-g, adbSNP:116500181
complement(5875)-t, cdbSNP:376434814
complement(5921)-g, adbSNP:113820201
complement(6021)-c, adbSNP:56247486
complement(6135)-g, adbSNP:373535351
complement(6137)-t, cdbSNP:180780531
complement(6158)-t, cdbSNP:188411829
complement(6293)-t, cdbSNP:74103025
Gene SymbolTGFBR3
Gene Synonymbetaglycan; BGCAN
Chromosome1
Locus Map1p33-p32
Title Glucocorticoids recruit Tgfbr3 and Smad1 to shift transforming growth factor-beta signaling from the Tgfbr1/Smad2/3 axis to the Acvrl1/Smad1 axis in lung fibroblasts .
Author Schwartze JT, Becker S, Sakkas E, Wujak LA, Niess G, Usemann J, Reichenberger F, Herold S, Vadasz I, Mayer K, Seeger W and Morty RE.
Journal J. Biol. Chem. 289 (6), 3262-3275 (2014)
Title Type III TGF-beta receptor promotes FGF2-mediated neuronal differentiation in neuroblastoma .
Author Knelson,E.H., Gaviglio,A.L., Tewari,A.K., Armstrong,M.B., Mythreye,K. and Blobe,G.C.
Journal J. Clin. Invest. 123 (11), 4786-4798 (2013)
Title Betaglycan alters NFkappaB-TGFbeta2 cross talk to reduce survival of human granulosa tumor cells .
Author Bilandzic M, Chu S, Wang Y, Tan HL, Fuller PJ, Findlay JK and Stenvers KL.
Journal Mol. Endocrinol. 27 (3), 466-479 (2013)
Title Roles for the type III TGF-beta receptor in human cancer .
Author Gatza CE, Oh SY and Blobe GC.
Journal Cell. Signal. 22 (8), 1163-1174 (2010)
Title Expression of the type III TGF-beta receptor is negatively regulated by TGF-beta .
Author Hempel N, How T, Cooper SJ, Green TR, Dong M, Copland JA, Wood CG and Blobe GC.
Journal Carcinogenesis 29 (5), 905-912 (2008)
Title Assignment of human transforming growth factor-beta type I and type .
Author Johnson DW, Qumsiyeh M, Benkhalifa M and Marchuk DA.
Journal Genomics 28 (2), 356-357 (1995)
Title Molecular cloning and characterization of the human and porcine transforming growth factor-beta type III receptors .
Author Moren A, Ichijo H and Miyazono K.
Journal Biochem. Biophys. Res. Commun. 189 (1), 356-362 (1992)
Title Receptors for the TGF-beta family .
Author Massague J.
Journal Cell 69 (7), 1067-1070 (1992)
Title Expression cloning and characterization of the TGF-beta type III receptor .
Author Wang XF, Lin HY, Ng-Eaton E, Downward J, Lodish HF and Weinberg RA.
Journal Cell 67 (4), 797-805 (1991)
Title Structure and expression of the membrane proteoglycan betaglycan, a component of the TGF-beta receptor system .
Author Lopez-Casillas F, Cheifetz S, Doody J, Andres JL, Lane WS and Massague J.
Journal Cell 67 (4), 785-795 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.