• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens endoplasmic reticulum aminopeptidase 1 (ERAP1), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001198541 Homo sapiens endoplasmic reticulum aminopeptidase 1 (ERAP1), transcript variant 3, mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_001198541.1, 309747090
Length 4843 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens endoplasmic reticulum aminopeptidase 1 (ERAP1), transcript variant 3, mRNA.
Product endoplasmic reticulum aminopeptidase 1 isoform b
Comment

Summary: The protein encoded by this gene is an aminopeptidase involved in trimming HLA class I-binding precursors so that they can be presented on MHC class I molecules. The encoded protein acts as a monomer or as a heterodimer with ERAP2. This protein may also be involved in blood pressure regulation by inactivation of angiotensin II. Three transcript variants encoding two different isoforms have been found for this gene.[provided by RefSeq, Oct 2010].


Transcript Variant: This variant (3) differs in the 3' UTR and coding sequence and in the 5' UTR compared to variant 1. The resulting isoform (b) has a shorter and distinct C-terminus compared to isoform a. Variants 2 and 3 both encode the same isoform.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001185470.1
CDS 106..2931
Misc Feature(1)94..96
Misc Feature(2)94..96
Misc Feature(3)109..168
Misc Feature(4)109..168
Misc Feature(5)262..1428
Misc Feature(6)286..1698
Misc Feature(7)1054..1068
Misc Feature(8)order(1162..1164,1174..1176,1231..1233)
Misc Feature(9)1417..1419
Misc Feature(10)1894..2853
Exon (1)1..88
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (2)89..629
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (3)630..768
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (4)769..903
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (5)904..1024
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (6)1025..1179
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (7)1180..1293
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (8)1294..1425
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (9)1426..1557
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (10)1558..1629
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (11)1630..1784
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (12)1785..1864
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (13)1865..2048
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (14)2049..2205
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (15)2206..2390
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (16)2391..2552
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (17)2553..2693
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (18)2694..2775
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Exon (19)2776..4843
Gene:ERAP1
Gene Synonym:A-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Translation MVFLPLKWSLATMSFLLSSLLALLTVSTPSWCQSTEASPKRSDGTPFPWNKIRLPEYVIP VHYDLLIHANLTTLTFWGTTKVEITASQPTSTIILHSHHLQISRATLRKGAGERLSEEPL QVLEHPRQEQIALLAPEPLLVGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTV KMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIP YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVAHELAHQWF GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFDAMEVDALNSSHPVS TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWD SMASICPTDGVKGMDGFCSRSQHSSSSSHWHQEGVDVKTMMNTWTLQKGFPLITITVRGR NVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKF NVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDL SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEG SVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTE GWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIG RNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKE NGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(125)-t, cdbSNP:112161107
complement(132)-g, adbSNP:141607437
complement(140)-g, adbSNP:72773968
complement(159)-g, adbSNP:144373640
complement(173)-g, adbSNP:201547987
complement(201)-g, adbSNP:149643795
complement(271)-g, adbSNP:3734016
complement(276)-g, adbSNP:145825678
complement(285)-t, cdbSNP:116041014
complement(307)-g, adbSNP:138846351
complement(309)-g, adbSNP:73148308
complement(321)-g, adbSNP:140922324
complement(340)-t, cdbSNP:151040768
complement(453)-g, c, adbSNP:143595169
complement(462)-g, adbSNP:184352763
complement(485)-g, cdbSNP:26653
complement(492)-t, cdbSNP:200537692
complement(500)-g, adbSNP:147823699
complement(513)-g, c, adbSNP:113481697
complement(529)-t, cdbSNP:149653730
complement(536)-g, adbSNP:140515309
complement(537)-c, adbSNP:147576297
complement(566)-t, cdbSNP:201670295
complement(572)-g, cdbSNP:201066303
complement(586)-t, cdbSNP:149909757
complement(606)-g, cdbSNP:138997764
complement(625)-g, adbSNP:150727280
complement(628)-t, adbSNP:141992697
complement(656)-dbSNP:
complement(656)-g, cdbSNP:142482678
complement(657)-g, adbSNP:201090317
complement(665)-g, cdbSNP:139782060
complement(701)-c, adbSNP:146396644
complement(718)-t, cdbSNP:200284630
complement(761)-g, adbSNP:112160177
complement(764)-g, adbSNP:142097626
complement(786)-dbSNP:
complement(786)-g, adbSNP:111940602
complement(852)-g, adbSNP:138975720
complement(880)-t, cdbSNP:143271510
complement(898)-t, cdbSNP:149597747
complement(933)-dbSNP:
complement(933)-t, cdbSNP:26618
complement(955)-t, cdbSNP:112686030
complement(976)-c, adbSNP:150415434
complement(1000)-t, gdbSNP:118132132
complement(1005)-t, cdbSNP:141427963
complement(1068)-dbSNP:
complement(1068)-g, adbSNP:147839365
complement(1083)-t, adbSNP:146163901
complement(1142)-t, cdbSNP:27895
complement(1150)-t, cdbSNP:2287987
complement(1173)-g, adbSNP:27434
complement(1177)-g, cdbSNP:113607082
complement(1179)-t, cdbSNP:201397000
complement(1296)-dbSNP:
complement(1296)-t, adbSNP:148857249
complement(1321)-t, cdbSNP:181668902
complement(1323)-g, c, adbSNP:145458413
complement(1356)-g, adbSNP:3213809
complement(1373)-g, adbSNP:111453713
complement(1378)-t, cdbSNP:139815574
complement(1390)-t, cdbSNP:146386179
complement(1444)-dbSNP:
complement(1444)-t, cdbSNP:184320964
complement(1464)-g, adbSNP:27529
complement(1465)-t, cdbSNP:140121905
complement(1470)-g, adbSNP:202098147
complement(1471)-t, cdbSNP:150674566
complement(1477)-t, cdbSNP:141891516
complement(1503)-t, cdbSNP:148124787
complement(1558)-dbSNP:
complement(1558)-t, cdbSNP:199837380
complement(1587)-t, cdbSNP:144737304
complement(1591)-t, cdbSNP:191646005
complement(1599)-g, adbSNP:201093556
complement(1611)-t, cdbSNP:142948882
complement(1645)-dbSNP:
complement(1645)-t, cdbSNP:78649652
complement(1688)-t, cdbSNP:30187
complement(1718)-t, cdbSNP:142305981
complement(1722)-g, cdbSNP:2278017
complement(1771)-t, cdbSNP:61734613
complement(1775)-g, adbSNP:182529691
complement(1782)-c, adbSNP:150362009
complement(1828)-dbSNP:
complement(1828)-t, cdbSNP:10050860
complement(1829)-t, cdbSNP:6863093
complement(1866)-dbSNP:
complement(1866)-g, adbSNP:143293248
complement(1868)-c, adbSNP:114703312
complement(1912)-t, cdbSNP:189721036
complement(1922)-t, cdbSNP:146434826
complement(1933)-c, adbSNP:76433375
complement(1944)-c, adbSNP:149374891
complement(1957)-c, adbSNP:201856260
complement(1965)-g, cdbSNP:143881089
complement(1976)-, adbSNP:34212508
complement(1986)-t, cdbSNP:113465538
complement(2012)-t, cdbSNP:144333828
complement(2016)-t, cdbSNP:469783
complement(2038)-g, adbSNP:139359454
complement(2043)-g, adbSNP:76598089
complement(2044)-t, cdbSNP:111363347
complement(2051)-dbSNP:
complement(2051)-g, adbSNP:147252760
complement(2068)-t, cdbSNP:201253143
complement(2093)-t, cdbSNP:143726979
complement(2094)-g, cdbSNP:148070748
complement(2121)-t, gdbSNP:143605421
complement(2172)-t, cdbSNP:150327661
complement(2237)-dbSNP:
complement(2237)-g, adbSNP:138598123
complement(2242)-t, gdbSNP:201469459
complement(2279)-t, cdbSNP:17482078
complement(2285)-g, adbSNP:112266389
complement(2288)-t, cdbSNP:201805082
complement(2293)-g, cdbSNP:27044
complement(2307)-g, adbSNP:201922813
complement(2313)-c, adbSNP:200156544
complement(2334)-g, adbSNP:146423238
complement(2346)-t, cdbSNP:145290126
complement(2350)-t, cdbSNP:202045893
complement(2370)-g, cdbSNP:145659288
complement(2394)-dbSNP:
complement(2394)-t, cdbSNP:61745685
complement(2401)-t, cdbSNP:151103435
complement(2472)-g, adbSNP:142985224
complement(2558)-dbSNP:
complement(2558)-c, adbSNP:138617866
complement(2601)-g, adbSNP:80088786
complement(2621)-g, adbSNP:147939272
complement(2647)-g, adbSNP:17481856
complement(2656)-t, gdbSNP:140865304
complement(2726)-dbSNP:
complement(2726)-g, adbSNP:147242644
complement(2765)-t, cdbSNP:200571600
complement(2766)-t, cdbSNP:201134181
complement(2811)-dbSNP:
complement(2811)-t, adbSNP:12523
complement(2847)-t, gdbSNP:201123726
complement(2849)-g, adbSNP:139576768
complement(2862)-t, gdbSNP:150789101
complement(2863)-t, cdbSNP:200883678
complement(2892)-g, adbSNP:146333496
complement(2924)-t, cdbSNP:111774449
complement(2948)-c, adbSNP:1065407
complement(2960)-g, adbSNP:201808461
complement(3026)-t, cdbSNP:10515248
complement(3077)-g, adbSNP:27985
complement(3101..3102)-, gcccattcatgaaaaadbSNP:72058134
complement(3102..3103)-, tttttcatgaatgggcdbSNP:3832369
complement(3103..3104)-, agcccattcatgaaaadbSNP:142866043
complement(3226)-, tdbSNP:201797543
complement(3226)-t, gdbSNP:112855255
complement(3229..3230)-, tgdbSNP:148692674
complement(3229)-t, gdbSNP:113677417
complement(3252)-g, adbSNP:17481334
complement(3305)-g, adbSNP:10515247
complement(3306)-t, cdbSNP:193020890
complement(3488)-g, cdbSNP:148667753
complement(3530)-t, cdbSNP:144126367
complement(3562)-g, adbSNP:149543777
complement(3584)-g, adbSNP:73144440
complement(3592)-g, adbSNP:188678105
complement(3650)-g, cdbSNP:147363327
complement(3660)-g, adbSNP:13160562
complement(3729)-t, adbSNP:72773917
complement(3758..3759)-, aagdbSNP:137948607
complement(3762)-t, cdbSNP:185063109
complement(3789..3792)-, ctcadbSNP:1611099
complement(3791..3794)-, cactdbSNP:66517544
complement(3791)-t, adbSNP:399005
complement(3792)-g, cdbSNP:398316
complement(3803)-g, adbSNP:3198304
complement(3891..3892)-, adbSNP:199668091
complement(3935..3938)-, tagtdbSNP:138961474
complement(3982..3983)-, catdbSNP:80157234
complement(3986..3987)-, atcadbSNP:71902834
complement(3987..3988)-, atcadbSNP:34023349
complement(4027)-g, adbSNP:192948517
complement(4058..4061)-, aagadbSNP:61501216
complement(4059..4062)-, aaagdbSNP:146925065
complement(4059)-g, adbSNP:201772624
complement(4060..4063)-, aaaadbSNP:199642233
complement(4061)-, aagadbSNP:72507474
complement(4062)-, ctttdbSNP:3839300
complement(4154..4155)-, tgttdbSNP:141685529
complement(4182)-g, adbSNP:187308049
complement(4274..4275)-, tcaadbSNP:56349735
complement(4279..4280)-, aatcdbSNP:67353525
complement(4280..4281)-, aatcdbSNP:35316964
complement(4363)-t, cdbSNP:182605212
complement(4367..4368)-, cttdbSNP:55838324
complement(4369..4370)-, ctt, ttcdbSNP:35416079
complement(4370..4371)-, cttdbSNP:144167589
complement(4403..4405)-, tcadbSNP:56311676
complement(4404..4406)-, atcdbSNP:66516475
complement(4404..4405)-, tcdbSNP:35516223
complement(4409)-t, cdbSNP:56120748
complement(4422)-t, gdbSNP:6879878
complement(4426..4427)-, tdbSNP:138292903
complement(4435)-g, adbSNP:13601
complement(4449)-t, gdbSNP:11135480
complement(4487)-g, adbSNP:7861
complement(4609)-t, adbSNP:142703274
complement(4631..4632)-, tdbSNP:143366467
complement(4643)-t, adbSNP:200495924
complement(4717)-t, cdbSNP:186627243
complement(4820)-t, adbSNP:7063
Gene SymbolERAP1
Gene SynonymA-LAP; ALAP; APPILS; ARTS-1; ARTS1; ERAAP; ERAAP1; PILS-AP; PILSAP
Chromosome5
Locus Map5q15
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001040458 Homo sapiens endoplasmic reticulum aminopeptidase 1 (ERAP1), transcript variant 2, mRNA. In-stock $809.00 $760.00 15
NM_001198541 Homo sapiens endoplasmic reticulum aminopeptidase 1 (ERAP1), transcript variant 3, mRNA. In-stock $809.00 $760.00 15
NM_016442 Homo sapiens endoplasmic reticulum aminopeptidase 1 (ERAP1), transcript variant 1, mRNA. On-demand $899.00 20
Title Genome-wide association analysis identifies new susceptibility loci for Behcet's disease and epistasis between HLA-B*51 and ERAP1 .
Author Kirino,Y., Bertsias,G., Ishigatsubo,Y., Mizuki,N., Tugal-Tutkun,I., Seyahi,E., Ozyazgan,Y., Sacli,F.S., Erer,B., Inoko,H., Emrence,Z., Cakar,A., Abaci,N., Ustek,D., Satorius,C., Ueda,A., Takeno,M., Kim,Y., Wood,G.M., Ombrello,M.J., Meguro,A., Gul,A., Remmers,E.F. and Kastner,D.L.
Journal Nat. Genet. 45 (2), 202-207 (2013)
Title Exploring ankylosing spondylitis-associated ERAP1, IL23R and IL12B gene polymorphisms in subphenotypes of psoriatic arthritis .
Author Jadon,D., Tillett,W., Wallis,D., Cavill,C., Bowes,J., Waldron,N., Dixon,A., Sengupta,R., Barton,A., Korendowych,E. and McHugh,N.J.
Journal Rheumatology (Oxford) 52 (2), 261-266 (2013)
Title Genetic association with ERAP1 in psoriasis is confined to disease onset after puberty and not dependent on HLA-C*06 .
Author Lysell,J., Padyukov,L., Kockum,I., Nikamo,P. and Stahle,M.
Journal J. Invest. Dermatol. 133 (2), 411-417 (2013)
Title Association between endoplasmic reticulum aminopeptidase-1 (ERAP-1) and susceptibility to ankylosing spondylitis in Iran .
Author Mahmoudi,M., Jamshidi,A.R., Amirzargar,A.A., Farhadi,E., Nourijelyani,K., Fallahi,S., Oraei,M., Noori,S. and Nicknam,M.H.
Journal Iran J Allergy Asthma Immunol 11 (4), 294-300 (2012)
Title Functional interaction of the ankylosing spondylitis-associated endoplasmic reticulum aminopeptidase 1 polymorphism and HLA-B27 in vivo .
Author Garcia-Medel,N., Sanz-Bravo,A., Van Nguyen,D., Galocha,B., Gomez-Molina,P., Martin-Esteban,A., Alvarez-Navarro,C. and de Castro,J.A.
Journal Mol. Cell Proteomics 11 (11), 1416-1429 (2012)
Title Identification of ARTS-1 as a novel TNFR1-binding protein that promotes TNFR1 ectodomain shedding .
Author Cui,X., Hawari,F., Alsaaty,S., Lawrence,M., Combs,C.A., Geng,W., Rouhani,F.N., Miskinis,D. and Levine,S.J.
Journal J. Clin. Invest. 110 (4), 515-526 (2002)
Title Identification of 33 polymorphisms in the adipocyte-derived leucine aminopeptidase (ALAP) gene and possible association with hypertension .
Author Yamamoto,N., Nakayama,J., Yamakawa-Kobayashi,K., Hamaguchi,H., Miyazaki,R. and Arinami,T.
Journal Hum. Mutat. 19 (3), 251-257 (2002)
Title Genomic organization of the human adipocyte-derived leucine aminopeptidase gene and its relationship to the placental leucine aminopeptidase/oxytocinase gene .
Author Hattori,A., Matsumoto,K., Mizutani,S. and Tsujimoto,M.
Journal J. Biochem. 130 (2), 235-241 (2001)
Title Characterization of recombinant human adipocyte-derived leucine aminopeptidase expressed in Chinese hamster ovary cells .
Author Hattori,A., Kitatani,K., Matsumoto,H., Miyazawa,S., Rogi,T., Tsuruoka,N., Mizutani,S., Natori,Y. and Tsujimoto,M.
Journal J. Biochem. 128 (5), 755-762 (2000)
Title Molecular cloning of adipocyte-derived leucine aminopeptidase highly related to placental leucine aminopeptidase/oxytocinase .
Author Hattori,A., Matsumoto,H., Mizutani,S. and Tsujimoto,M.
Journal J. Biochem. 125 (5), 931-938 (1999)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.