• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CD302 molecule (CD302), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001198763 Homo sapiens CD302 molecule (CD302), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_001198763.1, 311771589
Length 3821 bp
Structure linear
Update Date 20-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens CD302 molecule (CD302), transcript variant 2, mRNA.
Product CD302 antigen isoform 2 precursor
Comment

Summary: CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis (Kato et al., 2007 [PubMed 17947679]).[supplied by OMIM, Aug 2008].


Transcript Variant: This variant (2) lacks an alternate in-frame exon in the central coding region, compared to variant 1, resulting in an isoform (2) that is shorter than isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## Transcript exon combination :: AK304422.1, DC418893.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001185692.1
CDS 58..582
Misc Feature(1)127..>351
Exon (1)1..124
Gene:CD302
Gene Synonym:BIMLEC; CLEC13A; DCL-1; DCL1
Exon (2)125..235
Gene:CD302
Gene Synonym:BIMLEC; CLEC13A; DCL-1; DCL1
Exon (3)236..352
Gene:CD302
Gene Synonym:BIMLEC; CLEC13A; DCL-1; DCL1
Exon (4)353..379
Gene:CD302
Gene Synonym:BIMLEC; CLEC13A; DCL-1; DCL1
Exon (5)380..3805
Gene:CD302
Gene Synonym:BIMLEC; CLEC13A; DCL-1; DCL1
Translation MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHG ADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDVPYKRKYLSDNHILISALVIAS TVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQSPYNEDCVLVVGEENEYPVQFD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(60)-c, adbSNP:138846154
complement(70)-t, cdbSNP:374135673
complement(133)-dbSNP:
complement(133)-g, adbSNP:146371079
135+a, gdbSNP:2114626
complement(135)-t, cdbSNP:386557655
complement(141)-g, adbSNP:374632188
complement(157)-t, cdbSNP:140242404
complement(195)-t, cdbSNP:148084425
complement(244)-dbSNP:
complement(244)-t, cdbSNP:375356281
complement(282)-t, cdbSNP:149105310
complement(351)-c, adbSNP:371554523
complement(427)-dbSNP:
complement(427)-g, adbSNP:373864365
complement(467)-t, gdbSNP:200348184
complement(477)-g, adbSNP:144299382
complement(481)-c, adbSNP:34068933
complement(492)-t, gdbSNP:146382655
complement(517)-g, cdbSNP:144807087
complement(612)-t, cdbSNP:369067540
complement(620)-g, adbSNP:112102793
complement(721)-t, gdbSNP:140891491
complement(731..732)-, ttdbSNP:398080758
complement(731)-t, adbSNP:374308390
complement(733..734)-, aadbSNP:3836181
complement(785)-g, adbSNP:190364727
789+c, gdbSNP:3771721
complement(805)-g, adbSNP:116197392
complement(830)-t, cdbSNP:113199879
complement(930)-, adbSNP:375899594
complement(1005)-g, adbSNP:144339812
complement(1008)-g, adbSNP:185267452
complement(1023)-t, cdbSNP:193222017
complement(1030)-g, adbSNP:73967910
complement(1046)-t, adbSNP:372910186
complement(1357..1358)-, tcatgdbSNP:146634771
complement(1382)-, tdbSNP:368127540
complement(1530)-t, gdbSNP:34228039
complement(1537..1538)-, atcdbSNP:377196946
complement(1560)-g, adbSNP:149578219
complement(1583..1584)-, taagdbSNP:200402617
1627+c, gdbSNP:1126842
1662+a, cdbSNP:139328481
complement(1724)-g, adbSNP:150824327
complement(1764)-tt, gdbSNP:370285389
complement(1764)-t, gdbSNP:115180602
1865+c, gdbSNP:141430725
complement(1914)-g, adbSNP:187802665
complement(1938)-g, adbSNP:182059086
complement(1964)-g, adbSNP:17815040
complement(2046)-t, cdbSNP:17815029
complement(2059..2060)-, atcadbSNP:145789611
complement(2072)-, tdbSNP:72010824
complement(2195..2196)-, caatdbSNP:376190307
complement(2200)-t, cdbSNP:372991033
complement(2201..2202)-, atcadbSNP:151152086
complement(2228)-g, adbSNP:138116662
complement(2306)-, tdbSNP:35971754
2322+a, gdbSNP:1042666
2351+a, gdbSNP:11702
complement(2452)-t, cdbSNP:145527165
complement(2461..2462)-, adbSNP:35684172
complement(2476)-, adbSNP:374367161
complement(2571)-g, adbSNP:141870759
complement(2594)-g, adbSNP:369905090
complement(2646)-t, adbSNP:62173037
complement(2703..2704)-, tdbSNP:374570207
complement(2721)-g, adbSNP:114038657
complement(2773)-t, gdbSNP:199857812
complement(2774..2775)-, tadbSNP:397751296
complement(2779..2780)-, tadbSNP:142841729
complement(2788..2789)-, at, tadbSNP:58332704
complement(2789..2790)-, atdbSNP:34620033
complement(2790)-t, cdbSNP:199559120
complement(2791)-t, adbSNP:201615629
2792+c, tdbSNP:13939
2845+a, cdbSNP:1126851
complement(2852)-t, gdbSNP:138629857
2876+a, gdbSNP:1139546
complement(2964)-g, cdbSNP:75658831
complement(2965)-t, cdbSNP:143135371
complement(3103)-t, cdbSNP:10206114
complement(3217)-g, cdbSNP:13432
complement(3270)-g, adbSNP:186975609
complement(3324)-c, adbSNP:183407402
complement(3334)-g, adbSNP:78458873
complement(3382)-t, adbSNP:149056256
complement(3407)-g, adbSNP:3771723
complement(3466)-t, cdbSNP:191495190
complement(3703..3706)-, tgtcdbSNP:376620336
Gene SymbolCD302
Gene SynonymBIMLEC; CLEC13A; DCL-1; DCL1
Chromosome2
Locus Map2q24.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001198764 Homo sapiens CD302 molecule (CD302), transcript variant 3, mRNA. On-demand $399.00 14
NM_001198763 Homo sapiens CD302 molecule (CD302), transcript variant 2, mRNA. On-demand $399.00 14
NM_014880 Homo sapiens CD302 molecule (CD302), transcript variant 1, mRNA. In-stock $308.00 $259.00 10
Title DLC1 negatively regulates angiogenesis in a paracrine fashion .
Author Shih YP, Liao YC, Lin Y and Lo SH.
Journal Cancer Res. 70 (21), 8270-8275 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila S, Froeling FE, Tan A, Bonnard C, Boland GJ, Snippe H, Hibberd ML and Seielstad M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Characterization of DLC1-SAM equilibrium unfolding at the amino acid residue level .
Author Yang S, Noble CG and Yang D.
Journal Biochemistry 48 (19), 4040-4049 (2009)
Title The novel endocytic and phagocytic C-Type lectin receptor DCL-1/CD302 on macrophages is colocalized with F-actin, suggesting a role in cell adhesion and migration .
Author Kato M, Khan S, d'Aniello E, McDonald KJ and Hart DN.
Journal J. Immunol. 179 (9), 6052-6063 (2007)
Title Hodgkin's lymphoma cell lines express a fusion protein encoded by intergenically spliced mRNA for the multilectin receptor DEC-205 (CD205) and a novel C-type lectin receptor DCL-1 .
Author Kato M, Khan S, Gonzalez N, O'Neill BP, McDonald KJ, Cooper BJ, Angel NZ and Hart DN.
Journal J. Biol. Chem. 278 (36), 34035-34041 (2003)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.