Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA.
| RefSeq Version | NM_001198783.1, 311771666 |
| Length | 14038 bp |
| Structure | linear |
| Update Date | 13-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA. |
| Product | POU domain, class 2, transcription factor 1 isoform 2 |
| Comment | Summary: The OCT1 transcription factor was among the first identified members of the POU transcription factor family (summarized by Sturm et al., 1993 [PubMed 8314572]). Members of this family contain the POU domain, a 160-amino acid region necessary for DNA binding to the octameric sequence ATGCAAAT.[supplied by OMIM]. Transcript Variant: This variant (2) has an alternate 5' exon, as compared to variant 1. The resulting isoform (2) has a shorter and distinct N-terminus, as compared to isoform 1. |
| RefSeq | NP_001185712.1 |
| CDS | 236..2503 | Exon (1) | 1..263 | Exon (2) | 1..263 | Exon (3) | 264..329 | Exon (4) | 330..430 | Exon (5) | 431..484 | Exon (6) | 485..604 | Exon (7) | 605..793 | Exon (8) | 794..920 | Exon (9) | 921..1015 | Exon (10) | 1016..1189 | Exon (11) | 1190..1331 | Exon (12) | 1332..1471 | Exon (13) | 1472..1651 | Exon (14) | 1652..1757 | Exon (15) | 1758..2103 | Exon (16) | 2104..2192 | Exon (17) | 2193..14038 |
| Translation | MLDCSDYVLDSRMNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFL
GHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQ
ITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQ
PIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQL
PQQSQANLLQSQPSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEEL
EQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEK
WLNDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEE
ITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLV
TSSAATTLTVSPVLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSP
SASASTSEASSASETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANAS
LAAMAAAAGLNPSLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSL
PITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVAS
LHATSTSAESIQNSLFTVASASGAASTTTTASKAQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | POU2F1 |
| Gene Synonym | FLJ42836; OCT1; OTF1 |
| Chromosome | 1 |
| Locus Map | 1q24.2 |
| All Transcripts | NM_001198783 , NM_002697 , NM_001198786 |
| Title | OCT1 Expression in adipocytes could contribute to increased metformin action in obese subjects . |
| Author | Moreno-Navarrete,J.M., Ortega,F.J., Rodriguez-Hermosa,J.I., Sabater,M., Pardo,G., Ricart,W. and Fernandez-Real,J.M. |
| Journal | Diabetes 60 (1), 168-176 (2011) |
| Title | Association of the POU class 2 homeobox 1 gene (POU2F1) with susceptibility to Type 2 diabetes in Chinese populations . |
| Author | Ng,M.C., Lam,V.K., Tam,C.H., Chan,A.W., So,W.Y., Ma,R.C., Zee,B.C., Waye,M.M., Mak,W.W., Hu,C., Wang,C.R., Tong,P.C., Jia,W.P. and Chan,J.C. |
| Journal | Diabet. Med. 27 (12), 1443-1449 (2010) |
| Title | Facilitated DNA search by multidomain transcription factors: cross talk via a flexible linker . |
| Author | Vuzman,D., Polonsky,M. and Levy,Y. |
| Journal | Biophys. J. 99 (4), 1202-1211 (2010) |
| Title | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score . |
| Author | Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R. |
| Journal | Mol. Med. 16 (7-8), 247-253 (2010) |
| Title | Molecular reclassification of Crohn's disease by cluster analysis of genetic variants . |
| Author | Cleynen,I., Mahachie John,J.M., Henckaerts,L., Van Moerkercke,W., Rutgeerts,P., Van Steen,K. and Vermeire,S. |
| Journal | PLoS ONE 5 (9), E12952 (2010) |
| Title | Interaction of Oct-1 with TFIIB. Implications for a novel response elicited through the proximal octamer site of the lipoprotein lipase promoter . |
| Author | Nakshatri,H., Nakshatri,P. and Currie,R.A. |
| Journal | J. Biol. Chem. 270 (33), 19613-19623 (1995) |
| Title | Solution structure of the Oct-1 POU homeodomain determined by NMR and restrained molecular dynamics . |
| Author | Cox,M., van Tilborg,P.J., de Laat,W., Boelens,R., van Leeuwen,H.C., van der Vliet,P.C. and Kaptein,R. |
| Journal | J. Biomol. NMR 6 (1), 23-32 (1995) |
| Title | Differential phosphorylation of the transcription factor Oct1 during the cell cycle . |
| Author | Roberts,S.B., Segil,N. and Heintz,N. |
| Journal | Science 253 (5023), 1022-1026 (1991) |
| Title | The gene for the ubiquitous octamer-binding protein Oct-1 is on human chromosome 1, region cen-q32, and near Ly-22 and Ltw-4 on mouse chromosome 1 . |
| Author | Hsieh,C.L., Sturm,R., Herr,W. and Francke,U. |
| Journal | Genomics 6 (4), 666-672 (1990) |
| Title | The ubiquitous octamer-binding protein Oct-1 contains a POU domain with a homeo box subdomain . |
| Author | Sturm,R.A., Das,G. and Herr,W. |
| Journal | Genes Dev. 2 (12A), 1582-1599 (1988) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |