• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu11006 Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu11006C Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001198783.1, 311771666
Length 2268 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA.
Product POU domain, class 2, transcription factor 1 isoform 2
Comment

Summary: The OCT1 transcription factor was among the first identified members of the POU transcription factor family (summarized by Sturm et al., 1993 [PubMed 8314572]). Members of this family contain the POU domain, a 160-amino acid region necessary for DNA binding to the octameric sequence ATGCAAAT.[supplied by OMIM, Jul 2010].


Transcript Variant: This variant (2) has an alternate 5' exon, as compared to variant 1. The resulting isoform (2) has a shorter and distinct N-terminus, as compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001185712.1
CDS 236..2503
Misc Feature(1)83..85
Misc Feature(2)1109..1333
Misc Feature(3)1109..1333
Misc Feature(4)1409..1579
Misc Feature(5)order(1409..1423,1427..1429,1478..1480,1496..1498,
Misc Feature(6)order(1415..1417,1424..1426,1544..1546,1553..1558,
Exon (1)1..263
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (2)264..329
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (3)330..430
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (4)431..484
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (5)485..604
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (6)605..793
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (7)794..920
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (8)921..1015
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (9)1016..1189
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (10)1190..1331
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (11)1332..1471
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (12)1472..1651
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (13)1652..1757
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (14)1758..2103
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (15)2104..2192
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (16)2193..14038
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Translation MLDCSDYVLDSRMNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFL GHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQ ITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQ PIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQL PQQSQANLLQSQPSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEEL EQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEK WLNDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEE ITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLV TSSAATTLTVSPVLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSP SASASTSEASSASETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANAS LAAMAAAAGLNPSLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSL PITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVAS LHATSTSAESIQNSLFTVASASGAASTTTTASKAQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
67+dbSNP:
67+a, gdbSNP:192995765
283+dbSNP:
283+a, gdbSNP:148016183
317+a, gdbSNP:373034407
324+a, gdbSNP:148275114
334+dbSNP:
334+a, cdbSNP:186482381
373+c, tdbSNP:369768058
384+c, gdbSNP:147145536
388+c, tdbSNP:372659780
391+a, tdbSNP:142902719
414+c, tdbSNP:369523372
439+dbSNP:
439+c, tdbSNP:34899926
463+c, tdbSNP:138445591
481+a, gdbSNP:41270710
486+dbSNP:
486+c, tdbSNP:372720911
492+c, tdbSNP:144698259
497+a, gdbSNP:146790721
502+a, tdbSNP:144501162
504+c, tdbSNP:141034916
505+a, gdbSNP:371323065
513+c, tdbSNP:376193098
542+c, tdbSNP:77105959
592+a, gdbSNP:372016100
615+dbSNP:
615+c, tdbSNP:375705900
706+a, gdbSNP:376548311
714+c, tdbSNP:200977109
734+a, gdbSNP:376733697
751+a, cdbSNP:202204364
764+c, tdbSNP:141125384
805+dbSNP:
805+a, gdbSNP:138657088
835+c, tdbSNP:148064782
850+a, gdbSNP:374261952
883+a, gdbSNP:372294440
903+c, tdbSNP:141721802
926+dbSNP:
926+c, tdbSNP:34958084
934+a, gdbSNP:376220117
945+a, tdbSNP:1136938
988+g, tdbSNP:149991945
998+a, gdbSNP:368563634
1016+dbSNP:
1016+c, gdbSNP:148802820
1028+a, gdbSNP:142378150
1031+c, tdbSNP:145849668
1039+a, gdbSNP:371592449
1089+a, gdbSNP:141090058
complement(1102)-g, cdbSNP:148052368
1171+c, tdbSNP:150303199
1219+dbSNP:
1219+a, gdbSNP:149539541
1388+dbSNP:
1388+a, gdbSNP:199628925
1432+a, gdbSNP:141773470
1501+dbSNP:
1501+c, tdbSNP:113452871
1526+a, gdbSNP:12030882
1591+a, cdbSNP:190679158
1657+dbSNP:
1657+a, gdbSNP:139631897
1680+a, gdbSNP:141824617
1693+c, tdbSNP:139942805
1725+c, tdbSNP:371095333
1746+c, tdbSNP:373517501
1786+a, gdbSNP:199802231
1792+c, tdbSNP:7534943
1793+a, gdbSNP:145573672
1807+a, gdbSNP:375483299
1813+a, gdbSNP:2229284
1825+a, gdbSNP:368963193
1831+a, gdbSNP:372332412
1922+a, gdbSNP:150929565
1981+a, gdbSNP:368884325
2141+dbSNP:
2141+a, gdbSNP:371507009
2259+a, gdbSNP:117780267
2263+a, gdbSNP:34658638
2277+a, gdbSNP:145474237
2281+c, tdbSNP:376371881
2359+c, tdbSNP:370192498
2435+c, tdbSNP:34379394
2470+a, gdbSNP:373597853
2519..2520+at, gcdbSNP:34206998
2519+a, gdbSNP:74119502
2520+c, tdbSNP:74121903
2529+g, tdbSNP:370071032
2531+c, gdbSNP:374454199
2541+a, gdbSNP:386523002
2541+c, tdbSNP:12140508
2552+c, tdbSNP:367761426
2600+c, gdbSNP:1059761
2602+c, tdbSNP:147488593
2603+a, c, gdbSNP:192681274
2634..2635+, adbSNP:35216157
2634+a, gdbSNP:199706857
2648..2649+, aadbSNP:398053500
2649..2650+, adbSNP:397754703
2666+a, cdbSNP:200971601
2699+c, tdbSNP:184530699
2768+c, tdbSNP:11809726
2779+a, tdbSNP:200971398
2780..2781+, tadbSNP:367949135
2781+, adbSNP:34032944
2800+a, gdbSNP:202121011
2800+, gdbSNP:370665346
2804+a, cdbSNP:200559349
2809..2811+aaa, tdbSNP:386636481
2828+a, gdbSNP:114427946
2832+a, gdbSNP:116553865
2863+a, gdbSNP:139937573
2880+g, tdbSNP:78683311
2940..2941+, adbSNP:371666497
3007+c, tdbSNP:189746948
3015+a, gdbSNP:191814312
3058+a, gdbSNP:143903937
3067+a, cdbSNP:374386301
3079..3081+, ttgdbSNP:150254224
3082+, tdbSNP:368021095
3090+a, gdbSNP:184247208
3109+a, gdbSNP:188962278
3285+g, tdbSNP:111323349
3501+c, tdbSNP:147200790
3591+a, tdbSNP:12077940
3725+a, gdbSNP:367888136
3727..3728+, ttdbSNP:371753013
3833+a, cdbSNP:373437302
3848+c, tdbSNP:12737842
3884+c, tdbSNP:181758532
3914+a, gdbSNP:185659091
4015+c, gdbSNP:115087440
4070+a, gdbSNP:116709087
4112+c, tdbSNP:371073213
4125+c, tdbSNP:2995083
4192+c, tdbSNP:2949660
4265+a, cdbSNP:190577665
4295+g, tdbSNP:367633487
4373+a, gdbSNP:180813142
4428+a, tdbSNP:148664292
4749+a, tdbSNP:186090212
4849+a, gdbSNP:74121904
4890+g, tdbSNP:373918747
4903+a, gdbSNP:368358308
5097+a, tdbSNP:113008356
5229+a, gdbSNP:112728626
5291+a, gdbSNP:190110162
5628+c, tdbSNP:181346035
5704+a, gdbSNP:371778966
5755+a, gdbSNP:375530274
5780..5781+, tdbSNP:35786681
5868+a, gdbSNP:114759812
5929+a, gdbSNP:115094819
6025+c, tdbSNP:114044093
6059+c, tdbSNP:111244356
6078+a, gdbSNP:185906797
6091+c, gdbSNP:151211806
6149+a, cdbSNP:139042483
6222+a, gdbSNP:190668455
6267+c, gdbSNP:143974625
6401+c, tdbSNP:183595881
6439+a, gdbSNP:189033600
6589+a, gdbSNP:192048567
6647..6648+, gdbSNP:372160105
6745+a, gdbSNP:368311447
6823+a, gdbSNP:1214617
6862+, tdbSNP:10714431
6864+c, tdbSNP:78188536
6876+c, tdbSNP:75724693
6878..6879+c, tdbSNP:397832881
6879..6881+, tctdbSNP:75309870
6879+c, tdbSNP:1723013
6919+c, tdbSNP:1214618
6953+, tdbSNP:371867420
7012+a, gdbSNP:375793205
7015+c, tdbSNP:182758747
7045+c, tdbSNP:146458610
7057+a, gdbSNP:61806129
7075+g, tdbSNP:4657657
7098+c, gdbSNP:368716456
7116+a, gdbSNP:187639142
7217+g, tdbSNP:2902147
7242+c, tdbSNP:116431193
7277..7278+ac, gtdbSNP:386636482
7277+a, gdbSNP:1773541
7278+c, tdbSNP:1612096
7362+a, gdbSNP:77845893
7434+g, tdbSNP:140940299
7514+a, tdbSNP:370938032
7611+a, cdbSNP:374085802
7667+c, tdbSNP:373719279
7862+c, tdbSNP:75440123
7876+a, gdbSNP:201427736
7896+c, tdbSNP:191501038
7941..7942+, adbSNP:112317682
7942+a, gdbSNP:184029390
8146+c, tdbSNP:187169822
8173+a, tdbSNP:116502922
8191+, adbSNP:146833497
8344+a, gdbSNP:386467741
8344+c, tdbSNP:149180532
8348+a, gdbSNP:376714752
8357+a, tdbSNP:185285580
8656+a, gdbSNP:113636019
8706+a, tdbSNP:190574194
8856+c, tdbSNP:182186040
8954+a, gdbSNP:2949663
8957+a, gdbSNP:184337683
9003+, gdbSNP:111981321
9022+c, gdbSNP:143394814
9239+g, tdbSNP:16859005
9331..9332+, gdbSNP:35935514
9340+c, tdbSNP:116740621
9360+c, tdbSNP:2949664
9403+a, gdbSNP:148369062
9434+a, tdbSNP:188297847
9563..9564+, c, tdbSNP:34484181
9672+c, gdbSNP:2949665
9727+a, gdbSNP:372805883
9798+a, gdbSNP:2995094
9854+a, gdbSNP:370473637
9866+a, gdbSNP:181112062
9916+a, gdbSNP:141559674
9953+c, tdbSNP:79215482
9963+a, gdbSNP:77314208
9999+g, tdbSNP:147044655
10014+a, gdbSNP:2995097
10108+a, gdbSNP:138270282
10129+a, gdbSNP:143939381
10133+c, tdbSNP:115875428
10158+a, gdbSNP:2949666
10247+a, gdbSNP:185664229
10288+a, gdbSNP:61806130
10370+c, tdbSNP:35205612
10428+a, gdbSNP:190423853
10557+c, tdbSNP:74412420
10569+a, gdbSNP:375951024
10584+c, tdbSNP:4233416
10734+c, tdbSNP:181720005
10825+a, gdbSNP:371836817
10915+g, tdbSNP:116211240
11022+a, cdbSNP:144633590
11043+c, tdbSNP:186904469
11074+a, gdbSNP:373795634
complement(11091)-t, cdbSNP:885458
11091+c, tdbSNP:386619433
11102+g, tdbSNP:112853877
11156+a, gdbSNP:144141173
11171+a, gdbSNP:145953638
11175+a, gdbSNP:192139482
11177+c, tdbSNP:183908420
11198+a, cdbSNP:113727460
11230+c, gdbSNP:186516133
complement(11256)-t, cdbSNP:139807971
11455+c, tdbSNP:143278732
11522+a, gdbSNP:372121143
11542+c, tdbSNP:151156789
11543+a, gdbSNP:189684997
11657+c, gdbSNP:141054543
11730+a, tdbSNP:71632309
11738..11739+, tacdbSNP:149466164
11739..11740+, cta, tacdbSNP:72512421
11740..11741+, ctadbSNP:3070392
11741+c, tdbSNP:75426467
11757..11758+, attdbSNP:200432585
11895+a, gdbSNP:72693663
11918..11922+, tttgtdbSNP:150575731
11941+, gdbSNP:200049551
11947+c, tdbSNP:2995099
12004+a, cdbSNP:149815507
12079+a, gdbSNP:182360349
12192+c, tdbSNP:186928416
12316+, adbSNP:372146029
12340+a, gdbSNP:192775804
12386+a, gdbSNP:34539671
12596+a, cdbSNP:376626489
12659..12660+, gdbSNP:140616517
12811+a, gdbSNP:185146628
12902+c, tdbSNP:113925278
12931..12932+, aadbSNP:58096512
12931+a, tdbSNP:202031145
12938..12940+, aaadbSNP:74660565
complement(12939..12940)-, ttdbSNP:397981843
13127+a, gdbSNP:77373577
13243+c, tdbSNP:369486735
13258+a, gdbSNP:188466205
13299+c, tdbSNP:193206862
13396+g, tdbSNP:185589975
13492+a, tdbSNP:79168464
13511+a, tdbSNP:80016335
13629+a, gdbSNP:141885829
13663..13664+, gcdbSNP:372308360
13671+a, gdbSNP:189617521
13766+c, tdbSNP:372085087
13917+a, gdbSNP:376334472
13944+a, gdbSNP:191411510
Gene SymbolPOU2F1
Gene Synonymoct-1B; OCT1; OTF1
Chromosome1
Locus Map1q24.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001198783 Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA. On-demand $279.00 12-14
NM_001198783 Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA. On-demand $279.00 12-14
NM_001198783 Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA. On-demand $279.00 12-14
Title [The new isoform of Oct-1 transcription factor is transcribed from alternative promoter] .
Author Krylova,I.D., Portseva,T.N., Georgieva,S.G., Stepchenko,A.G. and Pankratova,E.V.
Journal Mol. Biol. (Mosk.) 47 (4), 634-641 (2013)
Title Regulation of Oct1/Pou2f1 transcription activity by O-GlcNAcylation .
Author Kang J, Shen Z, Lim JM, Handa H, Wells L and Tantin D.
Journal FASEB J. 27 (7), 2807-2817 (2013)
Title New alternative promoter in regulation of the Oct-1 human gene transcription .
Author Portseva TN, Krylova ID, Georgieva SG, Stepchenko AG and Pankratova EV.
Journal Dokl. Biochem. Biophys. 449, 72-74 (2013)
Title Oct-1 recruitment to the nuclear envelope in adult-onset autosomal dominant leukodystrophy .
Author Columbaro M, Mattioli E, Maraldi NM, Ortolani M, Gasparini L, D'Apice MR, Postorivo D, Nardone AM, Avnet S, Cortelli P, Liguori R and Lattanzi G.
Journal Biochim. Biophys. Acta 1832 (3), 411-420 (2013)
Title STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1 .
Author Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A and Mei Q.
Journal Carcinogenesis 34 (3), 678-688 (2013)
Title Interaction of Oct-1 with TFIIB. Implications for a novel response elicited through the proximal octamer site of the lipoprotein lipase promoter .
Author Nakshatri H, Nakshatri P and Currie RA.
Journal J. Biol. Chem. 270 (33), 19613-19623 (1995)
Title Solution structure of the Oct-1 POU homeodomain determined by NMR and restrained molecular dynamics .
Author Cox M, van Tilborg PJ, de Laat W, Boelens R, van Leeuwen HC, van der Vliet PC and Kaptein R.
Journal J. Biomol. NMR 6 (1), 23-32 (1995)
Title Differential phosphorylation of the transcription factor Oct1 during the cell cycle .
Author Roberts SB, Segil N and Heintz N.
Journal Science 253 (5023), 1022-1026 (1991)
Title The gene for the ubiquitous octamer-binding protein Oct-1 is on human chromosome 1, region cen-q32, and near Ly-22 and Ltw-4 on mouse chromosome 1 .
Author Hsieh CL, Sturm R, Herr W and Francke U.
Journal Genomics 6 (4), 666-672 (1990)
Title The ubiquitous octamer-binding protein Oct-1 contains a POU domain with a homeo box subdomain .
Author Sturm RA, Das G and Herr W.
Journal Genes Dev. 2 (12A), 1582-1599 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.