• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001198783 Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_001198783.1, 311771666
Length 14038 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA.
Product POU domain, class 2, transcription factor 1 isoform 2
Comment

Summary: The OCT1 transcription factor was among the first identified members of the POU transcription factor family (summarized by Sturm et al., 1993 [PubMed 8314572]). Members of this family contain the POU domain, a 160-amino acid region necessary for DNA binding to the octameric sequence ATGCAAAT.[supplied by OMIM, Jul 2010].


Transcript Variant: This variant (2) has an alternate 5' exon, as compared to variant 1. The resulting isoform (2) has a shorter and distinct N-terminus, as compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001185712.1
CDS 236..2503
Misc Feature(1)83..85
Misc Feature(2)1139..1318
Misc Feature(3)1139..1318
Misc Feature(4)1409..1579
Misc Feature(5)order(1409..1423,1427..1429,1478..1480,1496..1498,
Misc Feature(6)order(1415..1417,1424..1426,1544..1546,1553..1558,
Exon (1)1..263
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (2)264..329
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (3)330..430
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (4)431..484
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (5)485..604
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (6)605..793
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (7)794..920
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (8)921..1015
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (9)1016..1189
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (10)1190..1331
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (11)1332..1471
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (12)1472..1651
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (13)1652..1757
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (14)1758..2103
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (15)2104..2192
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Exon (16)2193..14038
Gene:POU2F1
Gene Synonym:oct-1B; OCT1; OTF1
Translation MLDCSDYVLDSRMNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFL GHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQ ITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQ PIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQL PQQSQANLLQSQPSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEEL EQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEK WLNDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEE ITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLV TSSAATTLTVSPVLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSP SASASTSEASSASETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANAS LAAMAAAAGLNPSLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSL PITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVAS LHATSTSAESIQNSLFTVASASGAASTTTTASKAQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
67+dbSNP:
67+a, gdbSNP:192995765
283+dbSNP:
283+a, gdbSNP:148016183
324+a, gdbSNP:148275114
334+dbSNP:
334+a, cdbSNP:186482381
384+c, gdbSNP:147145536
391+a, tdbSNP:142902719
439+dbSNP:
439+c, tdbSNP:34899926
463+c, tdbSNP:138445591
481+a, gdbSNP:41270710
492+dbSNP:
492+c, tdbSNP:144698259
497+a, gdbSNP:146790721
502+a, tdbSNP:144501162
504+c, tdbSNP:141034916
542+c, tdbSNP:77105959
714+dbSNP:
714+c, tdbSNP:200977109
751+a, cdbSNP:202204364
764+c, tdbSNP:141125384
805+dbSNP:
805+a, gdbSNP:138657088
835+c, tdbSNP:148064782
903+c, tdbSNP:141721802
926+dbSNP:
926+c, tdbSNP:34958084
945+a, tdbSNP:1136938
988+g, tdbSNP:149991945
1016+dbSNP:
1016+c, gdbSNP:148802820
1028+a, gdbSNP:142378150
1031+c, tdbSNP:145849668
1089+a, gdbSNP:141090058
1102+c, gdbSNP:148052368
1154+, tdbSNP:72057527
1171+c, tdbSNP:150303199
1219+dbSNP:
1219+a, gdbSNP:149539541
1388+dbSNP:
1388+a, gdbSNP:199628925
1432+a, gdbSNP:141773470
1501+dbSNP:
1501+c, tdbSNP:113452871
1526+a, gdbSNP:12030882
1591+a, cdbSNP:190679158
1657+dbSNP:
1657+a, gdbSNP:139631897
1680+a, gdbSNP:141824617
1693+c, tdbSNP:139942805
1786+a, gdbSNP:199802231
1792+c, tdbSNP:7534943
1793+a, gdbSNP:145573672
1813+a, gdbSNP:2229284
1922+a, gdbSNP:150929565
2259+a, gdbSNP:117780267
2263+a, gdbSNP:34658638
2277+a, gdbSNP:145474237
2435+c, tdbSNP:34379394
2519+a, gdbSNP:74119502
2520+at, gcdbSNP:34206998
2520+c, tdbSNP:74121903
2541+c, tdbSNP:12140508
2600+c, gdbSNP:1059761
2602+c, tdbSNP:147488593
2603+a, gdbSNP:192681274
2634+a, gdbSNP:199706857
2635..2636+, a, aadbSNP:35216157
2666+a, cdbSNP:200971601
2699+c, tdbSNP:184530699
2768+c, tdbSNP:11809726
2779+a, tdbSNP:200971398
2781+, adbSNP:34032944
2800+a, gdbSNP:202121011
2804+a, cdbSNP:200559349
2828+a, gdbSNP:114427946
2832+a, gdbSNP:116553865
2863+a, gdbSNP:139937573
2880+g, tdbSNP:78683311
3007+c, tdbSNP:189746948
3015+a, gdbSNP:191814312
3058+a, gdbSNP:143903937
3079..3081+, ttgdbSNP:150254224
3090+a, gdbSNP:184247208
3109+a, gdbSNP:188962278
3285+g, tdbSNP:111323349
3501+c, tdbSNP:147200790
3591+a, tdbSNP:12077940
3848+c, tdbSNP:12737842
3884+c, tdbSNP:181758532
3914+a, gdbSNP:185659091
4015+c, gdbSNP:115087440
4070+a, gdbSNP:116709087
4125+c, tdbSNP:2995083
4192+c, tdbSNP:2949660
4265+a, cdbSNP:190577665
4373+a, gdbSNP:180813142
4428+a, tdbSNP:148664292
4749+a, tdbSNP:186090212
4849+a, gdbSNP:74121904
5097+a, tdbSNP:113008356
5229+a, gdbSNP:112728626
5291+a, gdbSNP:190110162
5628+c, tdbSNP:181346035
5780..5781+, tdbSNP:35786681
5868+a, gdbSNP:114759812
5929+a, gdbSNP:115094819
6025+c, tdbSNP:114044093
6059+c, tdbSNP:111244356
6078+a, gdbSNP:185906797
6091+c, gdbSNP:151211806
6149+a, cdbSNP:139042483
6222+a, gdbSNP:190668455
6267+c, gdbSNP:143974625
6401+c, tdbSNP:183595881
6439+a, gdbSNP:189033600
6589+a, gdbSNP:192048567
6823+a, gdbSNP:1214617
6862+, tdbSNP:10714431
6864+c, tdbSNP:78188536
6876+c, tdbSNP:75724693
6879..6881+, tctdbSNP:75309870
6879+c, tdbSNP:1723013
6919+c, tdbSNP:1214618
7015+c, tdbSNP:182758747
7045+c, tdbSNP:146458610
7057+a, gdbSNP:61806129
7075+g, tdbSNP:4657657
7116+a, gdbSNP:187639142
7217+g, tdbSNP:2902147
7242+c, tdbSNP:116431193
7277+a, gdbSNP:1773541
7278+c, tdbSNP:1612096
7362+a, gdbSNP:77845893
7434+g, tdbSNP:140940299
7862+c, tdbSNP:75440123
7876+a, gdbSNP:201427736
7896+c, tdbSNP:191501038
7940..7941+, adbSNP:112317682
7942+a, gdbSNP:184029390
8146+c, tdbSNP:187169822
8173+a, tdbSNP:116502922
8191+, adbSNP:146833497
8344+c, tdbSNP:149180532
8357+a, tdbSNP:185285580
8656+a, gdbSNP:113636019
8706+a, tdbSNP:190574194
8856+c, tdbSNP:182186040
8954+a, gdbSNP:2949663
8957+a, gdbSNP:184337683
9003+, gdbSNP:111981321
9022+c, gdbSNP:143394814
9239+g, tdbSNP:16859005
9331..9332+, gdbSNP:35935514
9340+c, tdbSNP:116740621
9360+c, tdbSNP:2949664
9403+a, gdbSNP:148369062
9434+a, tdbSNP:188297847
9563..9564+, c, tdbSNP:34484181
9672+c, gdbSNP:2949665
9798+a, gdbSNP:2995094
9866+a, gdbSNP:181112062
9916+a, gdbSNP:141559674
9953+c, tdbSNP:79215482
9963+a, gdbSNP:77314208
9999+g, tdbSNP:147044655
10014+a, gdbSNP:2995097
10108+a, gdbSNP:138270282
10129+a, gdbSNP:143939381
10133+c, tdbSNP:115875428
10158+a, gdbSNP:2949666
10247+a, gdbSNP:185664229
10288+a, gdbSNP:61806130
10370+c, tdbSNP:35205612
10428+a, gdbSNP:190423853
10557+c, tdbSNP:74412420
10584+c, tdbSNP:4233416
10734+c, tdbSNP:181720005
10915+g, tdbSNP:116211240
11022+a, cdbSNP:144633590
11043+c, tdbSNP:186904469
11091+c, tdbSNP:885458
11102+g, tdbSNP:112853877
11156+a, gdbSNP:144141173
11171+a, gdbSNP:145953638
11175+a, gdbSNP:192139482
11177+c, tdbSNP:183908420
11198+a, cdbSNP:113727460
11230+c, gdbSNP:186516133
11256+c, tdbSNP:139807971
11455+c, tdbSNP:143278732
11542+c, tdbSNP:151156789
11543+a, gdbSNP:189684997
11657+c, gdbSNP:141054543
11730+a, tdbSNP:71632309
11735..11736+, ttadbSNP:71873524
11738..11739+, tacdbSNP:149466164
11739..11740+, ctadbSNP:72512421
11740..11741+, ctadbSNP:3070392
11741..11742+, ctadbSNP:72156207
11741+c, tdbSNP:75426467
11757..11758+, attdbSNP:200432585
11895+a, gdbSNP:72693663
11918..11922+, tttgtdbSNP:150575731
11941+, gdbSNP:200049551
11947+c, tdbSNP:2995099
12004+a, cdbSNP:149815507
12079+a, gdbSNP:182360349
12192+c, tdbSNP:186928416
12340+a, gdbSNP:192775804
12386+a, gdbSNP:34539671
12659..12660+, gdbSNP:140616517
12811+a, gdbSNP:185146628
12902+c, tdbSNP:113925278
12931..12933+, aaadbSNP:74660565
12931..12932+, aadbSNP:58096512
12931+, aadbSNP:5778548
12931+a, tdbSNP:202031145
13127+a, gdbSNP:77373577
13258+a, gdbSNP:188466205
13299+c, tdbSNP:193206862
13396+g, tdbSNP:185589975
13492+a, tdbSNP:79168464
13511+a, tdbSNP:80016335
13629+a, gdbSNP:141885829
13671+a, gdbSNP:189617521
13944+a, gdbSNP:191411510
Gene SymbolPOU2F1
Gene Synonymoct-1B; OCT1; OTF1
Chromosome1
Locus Map1q24.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001198783 Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 2, mRNA. On-demand $849.00 20
NM_001198786 Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 3, mRNA. On-demand $849.00 20
NM_002697 Homo sapiens POU class 2 homeobox 1 (POU2F1), transcript variant 1, mRNA. On-demand $899.00 20
Title STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1 .
Author Wang,Z., Zhu,S., Shen,M., Liu,J., Wang,M., Li,C., Wang,Y., Deng,A. and Mei,Q.
Journal Carcinogenesis 34 (3), 678-688 (2013)
Title Oncosecretomics coupled to bioenergetics identifies alpha-amino adipic acid, isoleucine and GABA as potential biomarkers of cancer: Differential expression of c-Myc, Oct1 and KLF4 coordinates metabolic changes .
Author Bellance,N., Pabst,L., Allen,G., Rossignol,R. and Nagrath,D.
Journal Biochim. Biophys. Acta 1817 (11), 2060-2071 (2012)
Title Oct-1 acts as a transcriptional repressor on the C-reactive protein promoter .
Author Voleti,B., Hammond,D.J. Jr., Thirumalai,A. and Agrawal,A.
Journal Mol. Immunol. 52 (3-4), 242-248 (2012)
Title Gadd45a transcriptional induction elicited by the Aurora kinase inhibitor MK-0457 in Bcr-Abl-expressing cells is driven by Oct-1 transcription factor .
Author Mancini,M., Leo,E., Aluigi,M., Marcozzi,C., Borsi,E., Barbieri,E. and Santucci,M.A.
Journal Leuk. Res. 36 (8), 1028-1034 (2012)
Title [Effects of hOCT1 and ABCB1 gene on the efficacy of imatinib mesylate in chronic myelocytic leukemia] .
Author Chen,W.W., Meng,F.Y., Zhong,J.S., Yin,C.X. and Wang,Z.X.
Journal Zhonghua Yi Xue Za Zhi 92 (20), 1405-1408 (2012)
Title Interaction of Oct-1 with TFIIB. Implications for a novel response elicited through the proximal octamer site of the lipoprotein lipase promoter .
Author Nakshatri,H., Nakshatri,P. and Currie,R.A.
Journal J. Biol. Chem. 270 (33), 19613-19623 (1995)
Title Solution structure of the Oct-1 POU homeodomain determined by NMR and restrained molecular dynamics .
Author Cox,M., van Tilborg,P.J., de Laat,W., Boelens,R., van Leeuwen,H.C., van der Vliet,P.C. and Kaptein,R.
Journal J. Biomol. NMR 6 (1), 23-32 (1995)
Title Differential phosphorylation of the transcription factor Oct1 during the cell cycle .
Author Roberts,S.B., Segil,N. and Heintz,N.
Journal Science 253 (5023), 1022-1026 (1991)
Title The gene for the ubiquitous octamer-binding protein Oct-1 is on human chromosome 1, region cen-q32, and near Ly-22 and Ltw-4 on mouse chromosome 1 .
Author Hsieh,C.L., Sturm,R., Herr,W. and Francke,U.
Journal Genomics 6 (4), 666-672 (1990)
Title The ubiquitous octamer-binding protein Oct-1 contains a POU domain with a homeo box subdomain .
Author Sturm,R.A., Das,G. and Herr,W.
Journal Genes Dev. 2 (12A), 1582-1599 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.