• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu09885 Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu09885C Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001199461.1, 313850993
Length 666 bp
Structure linear
Update Date 12-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA.
Product programmed cell death protein 2 isoform 3
Comment

Summary: This gene encodes a nuclear protein expressed in a variety of tissues. Expression of this gene has been shown to be repressed by B-cell CLL/lymphoma 6 (BCL6), a transcriptional repressor required for lymph node germinal center development, suggesting that BCL6 regulates apoptosis by its effects on this protein. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 9 and 12. [provided by RefSeq, Dec 2010].


Transcript Variant: This variant (3) differs in the 3' coding region and UTR, compared to variant 1. The resulting protein (isoform 3) has a shorter and distinct C-terminus, compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001186390.1
CDS 112..777
Misc Feature(1)514..627
Misc Feature(2)514..627
Exon (1)1..394
Gene:PDCD2
Gene Synonym:RP8; ZMYND7
Exon (2)395..637
Gene:PDCD2
Gene Synonym:RP8; ZMYND7
Exon (3)638..769
Gene:PDCD2
Gene Synonym:RP8; ZMYND7
Exon (4)770..1288
Gene:PDCD2
Gene Synonym:RP8; ZMYND7
Translation MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSF LLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPET GESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDH IIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(4)-dbSNP:
complement(4)-g, cdbSNP:113211980
complement(30)-t, cdbSNP:186446776
complement(46)-g, adbSNP:181785308
complement(84)-t, gdbSNP:78712376
complement(195)-g, adbSNP:371862236
complement(281)-t, gdbSNP:61756020
complement(282)-t, cdbSNP:376113327
complement(294)-c, adbSNP:189419068
complement(317)-g, cdbSNP:74482927
complement(327)-t, cdbSNP:200023629
complement(354)-g, adbSNP:200905773
372+g, tdbSNP:11557807
complement(373)-g, adbSNP:200184000
complement(374)-g, adbSNP:117413937
complement(388)-g, adbSNP:1129634
complement(395)-dbSNP:
complement(395)-t, adbSNP:148653243
complement(402)-c, adbSNP:146332925
complement(409)-g, adbSNP:372268684
complement(424)-c, adbSNP:367868951
complement(438)-g, adbSNP:142084425
complement(457)-t, gdbSNP:76108444
complement(465)-t, cdbSNP:375668108
complement(471)-t, adbSNP:73258640
complement(530..531)-, cdbSNP:145487503
complement(537)-g, adbSNP:139143204
complement(548)-c, adbSNP:372293466
complement(551)-g, cdbSNP:149555889
complement(565)-g, cdbSNP:368569104
complement(593)-t, gdbSNP:375620318
complement(615)-g, adbSNP:201859590
complement(636)-t, cdbSNP:183277217
complement(676)-dbSNP:
complement(676)-g, adbSNP:375838507
complement(694)-t, cdbSNP:373202680
complement(765)-t, gdbSNP:192662962
complement(794)-dbSNP:
complement(794)-t, cdbSNP:137952379
complement(835)-g, adbSNP:186453867
complement(899)-g, adbSNP:143812529
complement(905)-t, cdbSNP:373484547
complement(953)-g, adbSNP:183073999
complement(1058)-g, adbSNP:73258630
complement(1080)-t, adbSNP:12189695
complement(1127)-t, gdbSNP:11557805
complement(1139)-, tdbSNP:146081543
complement(1190)-t, adbSNP:190814380
complement(1203..1204)-, tadbSNP:374942961
complement(1262)-t, cdbSNP:148995772
complement(1277)-t, cdbSNP:185462539
complement(1281)-g, adbSNP:138944210
Gene SymbolPDCD2
Gene SynonymRP8; ZMYND7
Chromosome6
Locus Map6q27
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001199461 Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA. On-demand TBD TBD
NM_001199461 Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA. On-demand TBD TBD
NM_001199461 Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA. On-demand TBD TBD
NM_001199461 Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA. On-demand TBD TBD
NM_001199461 Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA. On-demand TBD TBD
NM_001199461 Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA. On-demand TBD TBD
NM_001199461 Homo sapiens programmed cell death 2 (PDCD2), transcript variant 3, mRNA. On-demand TBD TBD
Title Zfrp8/PDCD2 is required in ovarian stem cells and interacts with the piRNA pathway machinery .
Author Minakhina S, Changela N and Steward R.
Journal Development 141 (2), 259-268 (2014)
Title PDCD2 functions in cancer cell proliferation and predicts relapsed leukemia .
Author Barboza N, Minakhina S, Medina DJ, Balsara B, Greenwood S, Huzzy L, Rabson AB, Steward R and Schaar DG.
Journal Cancer Biol. Ther. 14 (6), 546-555 (2013)
Title PDCD2 knockdown inhibits erythroid but not megakaryocytic lineage differentiation of human hematopoietic stem/progenitor cells .
Author Kokorina NA, Granier CJ, Zakharkin SO, Davis S, Rabson AB and Sabaawy HE.
Journal Exp. Hematol. 40 (12), 1028-1042 (2012)
Title PDCD2, a protein whose expression is repressed by BCL6, induces apoptosis in human cells by activation of the caspase cascade .
Author Baron BW, Hyjek E, Gladstone B, Thirman MJ and Baron JM.
Journal Blood Cells Mol. Dis. 45 (2), 169-175 (2010)
Title Programmed cell death-2 isoform1 is ubiquitinated by parkin and increased in the substantia nigra of patients with autosomal recessive Parkinson's disease .
Author Fukae J, Sato S, Shiba K, Sato K, Mori H, Sharp PA, Mizuno Y and Hattori N.
Journal FEBS Lett. 583 (3), 521-525 (2009)
Title Cloning of cDNAs with PDCD2(C) domain and their expressions during apoptosis of HEK293T cells .
Author Chen Q, Qian K and Yan C.
Journal Mol. Cell. Biochem. 280 (1-2), 185-191 (2005)
Title Evaluation of IDDM8 susceptibility locus in a Russian simplex family data set .
Author Chistiakov DA, Seryogin YA, Turakulov RI, Savost'anov KV, Titovich EV, Zilberman LI, Kuraeva TL, Dedov II and Nosikov VV.
Journal J. Autoimmun. 24 (3), 243-250 (2005)
Title PDCD2 is a negative regulator of HCF-1 (C1) .
Author Scarr RB and Sharp PA.
Journal Oncogene 21 (34), 5245-5254 (2002)
Title The human programmed cell death-2 (PDCD2) gene is a target of BCL6 repression: implications for a role of BCL6 in the down-regulation of apoptosis .
Author Baron BW, Anastasi J, Thirman MJ, Furukawa Y, Fears S, Kim DC, Simone F, Birkenbach M, Montag A, Sadhu A, Zeleznik-Le N and McKeithan TW.
Journal Proc. Natl. Acad. Sci. U.S.A. 99 (5), 2860-2865 (2002)
Title Isolation and mapping of a human gene (PDCD2) that is highly homologous to Rp8, a rat gene associated with programmed cell death .
Author Kawakami T, Furukawa Y, Sudo K, Saito H, Takami S, Takahashi E and Nakamura Y.
Journal Cytogenet. Cell Genet. 71 (1), 41-43 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.