• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens bone morphogenetic protein 2 (BMP2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001200 Homo sapiens bone morphogenetic protein 2 (BMP2), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_001200.2, 80861484
Length 3150 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens bone morphogenetic protein 2 (BMP2), mRNA.
Product bone morphogenetic protein 2 preproprotein
Comment

Summary: The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. The encoded protein acts as a disulfide-linked homodimer and induces bone and cartilage formation. [provided by RefSeq, Jul 2008].

RefSeq NP_001191.1
CDS 786..1976
Misc Feature(1)774..776
Misc Feature(2)909..1586
Misc Feature(3)1671..1973
Exon (1)1..778
Gene:BMP2
Gene Synonym:BDA2; BMP2A
Exon (2)779..1131
Gene:BMP2
Gene Synonym:BDA2; BMP2A
Exon (3)1132..3150
Gene:BMP2
Gene Synonym:BDA2; BMP2A
Translation MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
113+dbSNP:
113+a, gdbSNP:141364472
172+a, gdbSNP:6054510
298+c, gdbSNP:2746245
417+c, gdbSNP:2746246
complement(424)-t, cdbSNP:2516847
438..440+, tgtdbSNP:201402819
894+g, tdbSNP:2273073
960+a, gdbSNP:147880089
989..1056+a, gdbSNP:79417223
1004+c, tdbSNP:377506952
1014+c, tdbSNP:36105541
1015+c, gdbSNP:151071707
1038+a, gdbSNP:369386883
1046+a, gdbSNP:1049007
1056+g, tdbSNP:373345005
1068+c, gdbSNP:375798188
1101+a, gdbSNP:2273074
1108+c, tdbSNP:374592377
1126+a, cdbSNP:368974118
1155+dbSNP:
1155+a, gdbSNP:201118225
1156+c, tdbSNP:150153389
1159+a, gdbSNP:138635436
1174+a, gdbSNP:201927971
1178+a, tdbSNP:140417301
1246+a, gdbSNP:111675841
1251+c, gdbSNP:200735108
1262+c, tdbSNP:192108769
1267+c, tdbSNP:34183594
1287+a, cdbSNP:373168490
1337+a, gdbSNP:142811428
1346+c, tdbSNP:149465465
1355+a, tdbSNP:235768
1374+c, gdbSNP:180897623
1389+a, gdbSNP:148232300
1415+c, tdbSNP:374359416
1419+a, gdbSNP:377749107
1429+a, gdbSNP:141178075
1437+a, gdbSNP:371085275
1439+a, gdbSNP:147301573
1449+a, gdbSNP:140884062
1458+a, gdbSNP:267606060
1469+a, gdbSNP:185968516
1495+a, gdbSNP:143336052
1556+g, tdbSNP:375357102
1573+c, tdbSNP:199628088
1577+a, gdbSNP:199987650
1591+a, gdbSNP:191265322
1615+a, gdbSNP:368389739
1651+a, gdbSNP:370948498
1676+a, gdbSNP:147542801
1691+c, tdbSNP:374065751
1706+c, tdbSNP:112449910
1709+c, gdbSNP:367930980
1748+c, tdbSNP:202210529
1760+c, tdbSNP:375907929
1763+c, tdbSNP:149993552
1764+a, gdbSNP:190569855
1815+a, gdbSNP:145193697
1825+c, tdbSNP:148745143
1826+a, gdbSNP:143654141
1874+a, gdbSNP:146731183
1889+c, tdbSNP:201750801
1895+a, gdbSNP:371434289
1910+c, tdbSNP:374701917
1913+c, gdbSNP:200531184
1936+a, gdbSNP:140326695
complement(1945)-t, cdbSNP:11545591
1946+c, tdbSNP:13037675
1972+a, gdbSNP:151019338
1999..2000+, atdbSNP:71646302
2007+a, gdbSNP:183175284
2059+c, tdbSNP:113839617
2107+a, tdbSNP:377335990
2156+a, tdbSNP:187880901
2220+a, cdbSNP:15705
2330+g, tdbSNP:193100537
2368+a, cdbSNP:6140085
2441+c, tdbSNP:3178250
2458+c, tdbSNP:368484108
2584+a, gdbSNP:235769
2603+c, tdbSNP:369318729
2607+a, cdbSNP:184273995
2628..2629+, gdbSNP:34291623
2653+a, tdbSNP:146623668
2671+a, cdbSNP:170986
2676+a, gdbSNP:187639339
2700+a, gdbSNP:192853631
2712+c, tdbSNP:372173053
2731+a, gdbSNP:183896584
2801+, gdbSNP:35995067
2908..2911+, atttdbSNP:144610334
2965+a, gdbSNP:188688099
2966+a, gdbSNP:181538581
2989+c, tdbSNP:140183493
3009+a, cdbSNP:184514007
3079+c, tdbSNP:375159082
Gene SymbolBMP2
Gene SynonymBDA2; BMP2A
Chromosome20
Locus Map20p12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001200 Homo sapiens bone morphogenetic protein 2 (BMP2), mRNA. In-stock $418.00 $369.00 10
Title BMP-2 expression correlates with local failure in head and neck squamous cell carcinoma .
Author Sand JP, Kokorina NA, Zakharkin SO, Lewis JS Jr and Nussenbaum B.
Journal Otolaryngol Head Neck Surg 150 (2), 245-250 (2014)
Title NOTCH1 signaling regulates the BMP2/DLX-3 directed osteogenic differentiation of dental follicle cells .
Author Viale-Bouroncle S, Gosau M and Morsczeck C.
Journal Biochem. Biophys. Res. Commun. 443 (2), 500-504 (2014)
Title Primitive CML cell expansion relies on abnormal levels of BMPs provided by the niche and on BMPRIb overexpression .
Author Laperrousaz B, Jeanpierre S, Sagorny K, Voeltzel T, Ramas S, Kaniewski B, Ffrench M, Salesse S, Nicolini FE and Maguer-Satta V.
Journal Blood 122 (23), 3767-3777 (2013)
Title Fluoride promotes viability and differentiation of osteoblast-like Saos-2 cells via BMP/Smads signaling pathway .
Author Huo L, Liu K, Pei J, Yang Y, Ye Y, Liu Y, Sun J, Han H, Xu W and Gao Y.
Journal Biol Trace Elem Res 155 (1), 142-149 (2013)
Title Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error .
Author Cheng CY, Schache M, Ikram MK, Young TL, Guggenheim JA, Vitart V, MacGregor S, Verhoeven VJ, Barathi VA, Liao J, Hysi PG, Bailey-Wilson JE, St Pourcain B, Kemp JP, McMahon G, Timpson NJ, Evans DM, Montgomery GW, Mishra A, Wang YX, Wang JJ, Rochtchina E, Polasek O, Wright AF, Amin N, van Leeuwen EM, Wilson JF, Pennell CE, van Duijn CM, de Jong PT, Vingerling JR, Zhou X, Chen P, Li R, Tay WT, Zheng Y, Chew M, Burdon KP, Craig JE, Iyengar SK, Igo RP Jr, Lass JH Jr, Chew EY, Haller T, Mihailov E, Metspalu A, Wedenoja J, Simpson CL, Wojciechowski R, Hohn R, Mirshahi A, Zeller T, Pfeiffer N, Lackner KJ, Bettecken T, Meitinger T, Oexle K, Pirastu M, Portas L, Nag A, Williams KM, Yonova-Doing E, Klein R, Klein BE, Hosseini SM, Paterson AD, Makela KM, Lehtimaki T, Kahonen M, Raitakari O, Yoshimura N, Matsuda F, Chen LJ, Pang CP, Yip SP, Yap MK, Meguro A, Mizuki N, Inoko H, Foster PJ, Zhao JH, Vithana E, Tai ES, Fan Q, Xu L, Campbell H, Fleck B, Rudan I, Aung T, Hofman A, Uitterlinden AG, Bencic G, Khor CC, Forward H, Parssinen O, Mitchell P, Rivadeneira F, Hewitt AW, Williams C, Oostra BA, Teo YY, Hammond CJ, Stambolian D, Mackey DA, Klaver CC, Wong TY, Saw SM and Baird PN.
Journal Am. J. Hum. Genet. 93 (2), 264-277 (2013)
Title The gene for bone morphogenetic protein 2A (BMP2A) is localized to human chromosome 20p12 by radioactive and nonradioactive in situ hybridization .
Author Rao VV, Loffler C, Wozney JM and Hansmann I.
Journal Hum. Genet. 90 (3), 299-302 (1992)
Title Bone morphogenetic protein: chromosomal localization of human genes for BMP1, BMP2A, and BMP3 .
Author Tabas JA, Zasloff M, Wasmuth JJ, Emanuel BS, Altherr MR, McPherson JD, Wozney JM and Kaplan FS.
Journal Genomics 9 (2), 283-289 (1991)
Title Bovine osteogenic protein is composed of dimers of OP-1 and BMP-2A, two members of the transforming growth factor-beta superfamily .
Author Sampath TK, Coughlin JE, Whetstone RM, Banach D, Corbett C, Ridge RJ, Ozkaynak E, Oppermann H and Rueger DC.
Journal J. Biol. Chem. 265 (22), 13198-13205 (1990)
Title Recombinant human bone morphogenetic protein induces bone formation .
Author Wang EA, Rosen V, D'Alessandro JS, Bauduy M, Cordes P, Harada T, Israel DI, Hewick RM, Kerns KM and LaPan P.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (6), 2220-2224 (1990)
Title Novel regulators of bone formation: molecular clones and activities .
Author Wozney JM, Rosen V, Celeste AJ, Mitsock LM, Whitters MJ, Kriz RW, Hewick RM and Wang EA.
Journal Science 242 (4885), 1528-1534 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.