• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens bone morphogenetic protein 2 (BMP2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001200 Homo sapiens bone morphogenetic protein 2 (BMP2), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_001200.2, 80861484
Length 3150 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens bone morphogenetic protein 2 (BMP2), mRNA.
Product bone morphogenetic protein 2 preproprotein
Comment

Summary: The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. The encoded protein acts as a disulfide-linked homodimer and induces bone and cartilage formation. [provided by RefSeq, Jul 2008].

RefSeq NP_001191.1
CDS 786..1976
Misc Feature(1)774..776
Misc Feature(2)909..1586
Misc Feature(3)1671..1973
Exon (1)1..778
Gene:BMP2
Gene Synonym:BDA2; BMP2A
Exon (2)779..1131
Gene:BMP2
Gene Synonym:BDA2; BMP2A
Exon (3)1132..3150
Gene:BMP2
Gene Synonym:BDA2; BMP2A
Translation MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
113+dbSNP:
113+a, gdbSNP:141364472
172+a, gdbSNP:6054510
298+c, gdbSNP:2746245
417+c, gdbSNP:2746246
424+c, tdbSNP:2516847
438..440+, tgtdbSNP:201402819
894+g, tdbSNP:2273073
960+a, gdbSNP:147880089
968+c, tdbSNP:148920913
989..1056+a, gdbSNP:79417223
990+c, gdbSNP:142772848
1014+c, tdbSNP:36105541
1015+c, gdbSNP:151071707
1046+a, gdbSNP:1049007
1101+a, gdbSNP:2273074
1155+dbSNP:
1155+a, gdbSNP:201118225
1156+c, tdbSNP:150153389
1159+a, gdbSNP:138635436
1174+a, gdbSNP:201927971
1178+a, tdbSNP:140417301
1246+a, gdbSNP:111675841
1251+c, gdbSNP:200735108
1262+c, tdbSNP:192108769
1267+c, tdbSNP:34183594
1337+a, gdbSNP:142811428
1346+c, tdbSNP:149465465
1355+a, tdbSNP:235768
1374+c, gdbSNP:180897623
1389+a, gdbSNP:148232300
1429+a, gdbSNP:141178075
1439+a, gdbSNP:147301573
1449+a, gdbSNP:140884062
1469+a, gdbSNP:185968516
1495+a, gdbSNP:143336052
1573+c, tdbSNP:199628088
1577+a, gdbSNP:199987650
1591+a, gdbSNP:191265322
1676+a, gdbSNP:147542801
1706+c, tdbSNP:112449910
1748+c, tdbSNP:202210529
1763+c, tdbSNP:149993552
1764+a, gdbSNP:190569855
1815+a, gdbSNP:145193697
1825+c, tdbSNP:148745143
1826+a, gdbSNP:143654141
1874+a, gdbSNP:146731183
1889+c, tdbSNP:201750801
1913+c, gdbSNP:200531184
1936+a, gdbSNP:140326695
1945+c, tdbSNP:11545591
1946+c, tdbSNP:13037675
1972+a, gdbSNP:151019338
1999..2000+, atdbSNP:71646302
2007+a, gdbSNP:183175284
2059+c, tdbSNP:113839617
2156+a, tdbSNP:187880901
2220+a, cdbSNP:15705
2330+g, tdbSNP:193100537
2368+a, cdbSNP:6140085
2441+c, tdbSNP:3178250
2584+a, gdbSNP:235769
2607+a, cdbSNP:184273995
2628..2629+, gdbSNP:34291623
2653+a, tdbSNP:146623668
2671+a, cdbSNP:170986
2676+a, gdbSNP:187639339
2700+a, gdbSNP:192853631
2731+a, gdbSNP:183896584
2798+, gdbSNP:35995067
2908..2911+, atttdbSNP:144610334
2965+a, gdbSNP:188688099
2966+a, gdbSNP:181538581
2989+c, tdbSNP:140183493
3009+a, cdbSNP:184514007
Gene SymbolBMP2
Gene SynonymBDA2; BMP2A
Chromosome20
Locus Map20p12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001200 Homo sapiens bone morphogenetic protein 2 (BMP2), mRNA. In-stock $418.00 $369.00 10
Title Wnt pathway regulation by demineralized bone is approximated by both BMP-2 and TGF-beta1 signaling .
Author Zhou,S., Mizuno,S. and Glowacki,J.
Journal J. Orthop. Res. 31 (4), 554-560 (2013)
Title Effect of rhBMP-2 and VEGF in a vascularized bone allotransplant experimental model based on surgical neoangiogenesis .
Author Mattar,T., Friedrich,P.F. and Bishop,A.T.
Journal J. Orthop. Res. 31 (4), 561-566 (2013)
Title BMP2/BMP4 colorectal cancer susceptibility loci in northern and southern European populations .
Author Fernandez-Rozadilla,C., Palles,C., Carvajal-Carmona,L., Peterlongo,P., Nici,C., Veneroni,S., Pinheiro,M., Teixeira,M.R., Moreno,V., Lamas,M.J., Baiget,M., Lopez-Fernandez,L.A., Gonzalez,D., Brea-Fernandez,A., Clofent,J., Bujanda,L., Bessa,X., Andreu,M., Xicola,R., Llor,X., Jover,R., Castells,A., Castellvi-Bel,S., Carracedo,A., Tomlinson,I. and Ruiz-Ponte,C.
Journal Carcinogenesis 34 (2), 314-318 (2013)
Title Myotubularin-related protein 4 (MTMR4) attenuates BMP/Dpp signaling by dephosphorylation of Smad proteins .
Author Yu,J., He,X., Chen,Y.G., Hao,Y., Yang,S., Wang,L., Pan,L. and Tang,H.
Journal J. Biol. Chem. 288 (1), 79-88 (2013)
Title A genome-wide association study identifies susceptibility loci for nonsyndromic sagittal craniosynostosis near BMP2 and within BBS9 .
Author Justice,C.M., Yagnik,G., Kim,Y., Peter,I., Jabs,E.W., Erazo,M., Ye,X., Ainehsazan,E., Shi,L., Cunningham,M.L., Kimonis,V., Roscioli,T., Wall,S.A., Wilkie,A.O., Stoler,J., Richtsmeier,J.T., Heuze,Y., Sanchez-Lara,P.A., Buckley,M.F., Druschel,C.M., Mills,J.L., Caggana,M., Romitti,P.A., Kay,D.M., Senders,C., Taub,P.J., Klein,O.D., Boggan,J., Zwienenberg-Lee,M., Naydenov,C., Kim,J., Wilson,A.F. and Boyadjiev,S.A.
Journal Nat. Genet. 44 (12), 1360-1364 (2012)
Title The gene for bone morphogenetic protein 2A (BMP2A) is localized to human chromosome 20p12 by radioactive and nonradioactive in situ hybridization .
Author Rao,V.V., Loffler,C., Wozney,J.M. and Hansmann,I.
Journal Hum. Genet. 90 (3), 299-302 (1992)
Title Bone morphogenetic protein: chromosomal localization of human genes for BMP1, BMP2A, and BMP3 .
Author Tabas,J.A., Zasloff,M., Wasmuth,J.J., Emanuel,B.S., Altherr,M.R., McPherson,J.D., Wozney,J.M. and Kaplan,F.S.
Journal Genomics 9 (2), 283-289 (1991)
Title Bovine osteogenic protein is composed of dimers of OP-1 and BMP-2A, two members of the transforming growth factor-beta superfamily .
Author Sampath,T.K., Coughlin,J.E., Whetstone,R.M., Banach,D., Corbett,C., Ridge,R.J., Ozkaynak,E., Oppermann,H. and Rueger,D.C.
Journal J. Biol. Chem. 265 (22), 13198-13205 (1990)
Title Recombinant human bone morphogenetic protein induces bone formation .
Author Wang,E.A., Rosen,V., D'Alessandro,J.S., Bauduy,M., Cordes,P., Harada,T., Israel,D.I., Hewick,R.M., Kerns,K.M., LaPan,P. et al.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (6), 2220-2224 (1990)
Title Novel regulators of bone formation: molecular clones and activities .
Author Wozney,J.M., Rosen,V., Celeste,A.J., Mitsock,L.M., Whitters,M.J., Kriz,R.W., Hewick,R.M. and Wang,E.A.
Journal Science 242 (4885), 1528-1534 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.