• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens bone morphogenetic protein receptor, type IB (BMPR1B), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001203 Homo sapiens bone morphogenetic protein receptor, type IB (BMPR1B), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_001203.2, 169790809
Length 5560 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens bone morphogenetic protein receptor, type IB (BMPR1B), transcript variant 2, mRNA.
Product bone morphogenetic protein receptor type-1B isoform b precursor
Comment

Summary: This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs, which are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in this gene have been associated with primary pulmonary hypertension. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2012].


Transcript Variant: This variant (3) differs in the 5' UTR and coding sequence compared to variant 1. The resulting isoform (b) is shorter at the N-terminus compared to isoform a. Variants 2, 3, and 4 all encode isoform b.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and published data.

RefSeq NP_001194.1
CDS 275..1783
Misc Feature(1)251..253
Misc Feature(2)362..604
Misc Feature(3)653..718
Misc Feature(4)794..880
Misc Feature(5)893..1741
Misc Feature(6)902..1501
Misc Feature(7)order(902..916,926..928,959..961,965..967,1049..1051,
Misc Feature(8)order(902..916,926..928,959..961,965..967,1049..1051,
Misc Feature(9)order(914..916,1130..1132,1136..1138,1268..1270,
Misc Feature(10)<1262..1756
Misc Feature(11)order(1268..1270,1274..1276,1280..1282,1331..1333,
Misc Feature(12)order(1319..1339,1391..1402)
Misc Feature(13)order(1319..1339,1391..1402)
Exon (1)1..92
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (2)93..162
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (3)163..257
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (4)258..417
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (5)418..520
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (6)521..623
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (7)624..720
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (8)721..859
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (9)860..1052
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (10)1053..1350
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (11)1351..1526
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (12)1527..1657
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Exon (13)1658..5560
Gene:BMPR1B
Gene Synonym:ALK-6; ALK6; CDw293
Translation MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEED DSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVD GPIHHRALLISVTVCSLLLVLIILFCYFRYKRQETRPRYSIGLEQDETYIPPGESLRDLI EQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEAS WFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKS MLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISD TNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIV EEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPAS RLTALRVKKTLAKMSESQDIKL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
93+dbSNP:
93+a, gdbSNP:143230133
146+a, gdbSNP:148290279
158+c, tdbSNP:75697273
245+dbSNP:
245+c, tdbSNP:117271963
285+a, gdbSNP:150974461
290+a, gdbSNP:143885868
311+a, gdbSNP:111612269
336+c, tdbSNP:190883013
346+c, gdbSNP:148603233
348+c, gdbSNP:145700191
366+a, gdbSNP:200035802
424+dbSNP:
424+c, tdbSNP:147320212
503+g, tdbSNP:200702974
522+dbSNP:
522+a, cdbSNP:140970485
524+a, tdbSNP:192392906
525+c, tdbSNP:200083866
529+c, tdbSNP:144813372
554+a, gdbSNP:200886063
555+a, tdbSNP:139161475
564+a, cdbSNP:151289886
574+c, tdbSNP:140499888
669+dbSNP:
669+g, tdbSNP:150002205
677+g, tdbSNP:145201971
692+a, gdbSNP:138801821
704+c, tdbSNP:55980670
719..720+, gdbSNP:35806331
719+c, tdbSNP:34231464
738+dbSNP:
738+a, cdbSNP:140360809
753+a, gdbSNP:149589961
797+c, tdbSNP:143554488
813+c, tdbSNP:148027483
821+c, tdbSNP:141691706
834+c, gdbSNP:200839585
873+dbSNP:
873+a, tdbSNP:121434417
879+a, gdbSNP:185062260
945+a, gdbSNP:35973133
979+c, tdbSNP:56083112
1019+c, gdbSNP:142696562
1020+a, tdbSNP:187868598
1033+a, gdbSNP:200446727
1036+g, tdbSNP:200198618
1043+a, gdbSNP:201034260
1110+dbSNP:
1110+c, tdbSNP:147336783
1165+a, cdbSNP:112111860
1175+a, gdbSNP:199613098
1253+a, gdbSNP:141032424
1309+g, tdbSNP:143267562
1339+a, tdbSNP:139872191
1349+a, gdbSNP:201289177
1373+dbSNP:
1373+c, tdbSNP:148550671
1386+a, gdbSNP:34970181
1411+c, tdbSNP:151056742
1421+c, tdbSNP:200523617
1513+a, tdbSNP:186299744
1641+dbSNP:
1641+a, gdbSNP:140047318
1708+dbSNP:
1708+a, c, tdbSNP:144080146
1730+c, tdbSNP:121434418
1731+a, gdbSNP:121434419
1741+a, gdbSNP:146773802
1750+c, tdbSNP:140430323
1792+c, gdbSNP:112333283
1832+c, tdbSNP:6813320
1856+a, gdbSNP:183489869
1924+a, gdbSNP:1434536
1960+c, tdbSNP:112992418
1978+c, tdbSNP:11725366
1979+c, tdbSNP:1836261
2072..2073+, tdbSNP:11436086
2073..2074+, tdbSNP:63230964
2085..2086+, tdbSNP:200763520
2085+a, tdbSNP:77552018
2087+a, gdbSNP:77149358
2121+c, tdbSNP:79791228
2196+a, gdbSNP:188703962
2247+a, gdbSNP:193193227
2270+g, tdbSNP:183245717
2389..2390+, acdbSNP:146159076
2424+c, tdbSNP:17023107
2586+, tttttttttttdbSNP:72112539
2614..2617+, tttt, tttttttttttdbSNP:57518558
2643+c, tdbSNP:188311185
2658..2679+, attcaaaggatcaatattaaatdbSNP:111971137
2673+a, gdbSNP:148298750
2693+a, gdbSNP:141438374
2723+a, gdbSNP:61443337
2772+a, gdbSNP:11097457
2774+a, tdbSNP:150827995
2791+a, gdbSNP:59105855
2796+c, tdbSNP:191551226
2896+a, gdbSNP:139279847
2899+a, tdbSNP:183694616
3144+a, gdbSNP:56738985
3254..3256+, aatdbSNP:145279069
3342+c, tdbSNP:2289044
3429..3430+, ttdbSNP:34119401
3429+g, tdbSNP:74645391
3490+a, gdbSNP:186753977
3754+c, gdbSNP:191224787
3755+a, cdbSNP:185854880
3765+, adbSNP:58613735
3776+a, tdbSNP:200257459
3832+g, tdbSNP:190367204
3939+c, tdbSNP:115505973
4115+a, tdbSNP:73839218
4133+a, gdbSNP:1863654
4194+a, tdbSNP:145989039
4216+a, gdbSNP:139936115
4236+a, gdbSNP:143459680
4279+a, gdbSNP:181930964
4559+c, tdbSNP:1434535
4805+a, gdbSNP:185008757
4817+a, gdbSNP:189906922
4836+a, gdbSNP:144649830
4842+c, tdbSNP:181152855
5002+c, tdbSNP:185607229
5004+a, gdbSNP:2162450
5038+c, gdbSNP:2162449
5046+c, tdbSNP:189974357
5060+a, tdbSNP:148400273
5086+a, gdbSNP:12505161
5111+a, gdbSNP:7676885
5272+a, gdbSNP:142488637
5401+a, gdbSNP:76804339
5436+c, tdbSNP:180838558
Gene SymbolBMPR1B
Gene SynonymALK-6; ALK6; CDw293
Chromosome4
Locus Map4q22-q24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001203 Homo sapiens bone morphogenetic protein receptor, type IB (BMPR1B), transcript variant 2, mRNA. On-demand $699.00 18
NM_001256792 Homo sapiens bone morphogenetic protein receptor, type IB (BMPR1B), transcript variant 3, mRNA. On-demand $699.00 18
NM_001256793 Homo sapiens bone morphogenetic protein receptor, type IB (BMPR1B), transcript variant 1, mRNA. On-demand $699.00 18
NM_001256794 Homo sapiens bone morphogenetic protein receptor, type IB (BMPR1B), transcript variant 4, mRNA. On-demand $699.00 18
Title Oligomeric interactions of TGF-beta and BMP receptors .
Author Ehrlich,M., Gutman,O., Knaus,P. and Henis,Y.I.
Journal FEBS Lett. 586 (14), 1885-1896 (2012)
Title A covalently dimerized recombinant human bone morphogenetic protein-15 variant identifies bone morphogenetic protein receptor type 1B as a key cell surface receptor on ovarian granulosa cells .
Author Pulkki,M.M., Mottershead,D.G., Pasternack,A.H., Muggalla,P., Ludlow,H., van Dinther,M., Myllymaa,S., Koli,K., ten Dijke,P., Laitinen,M. and Ritvos,O.
Journal Endocrinology 153 (3), 1509-1518 (2012)
Title A miR-125b binding site polymorphism in bone morphogenetic protein membrane receptor type IB gene and prostate cancer risk in China .
Author Feng,N., Xu,B., Tao,J., Li,P., Cheng,G., Min,Z., Mi,Y., Wang,M., Tong,N., Tang,J., Zhang,Z., Wu,H., Zhang,W., Wang,Z. and Hua,L.
Journal Mol. Biol. Rep. 39 (1), 369-373 (2012)
Title A genome-wide linkage and association scan reveals novel loci for hypertension and blood pressure traits .
Author Guo,Y., Tomlinson,B., Chu,T., Fang,Y.J., Gui,H., Tang,C.S., Yip,B.H., Cherny,S.S., Hur,Y.M., Sham,P.C., Lam,T.H. and Thomas,N.G.
Journal PLoS ONE 7 (2), E31489 (2012)
Title Missense mutations of the BMPR1B (ALK6) gene in childhood idiopathic pulmonary arterial hypertension .
Author Chida,A., Shintani,M., Nakayama,T., Furutani,Y., Hayama,E., Inai,K., Saji,T., Nonoyama,S. and Nakanishi,T.
Journal Circ. J. 76 (6), 1501-1508 (2012)
Title Identification of type I and type II serine/threonine kinase receptors for growth/differentiation factor-5 .
Author Nishitoh,H., Ichijo,H., Kimura,M., Matsumoto,T., Makishima,F., Yamaguchi,A., Yamashita,H., Enomoto,S. and Miyazono,K.
Journal J. Biol. Chem. 271 (35), 21345-21352 (1996)
Title Analysis of the native murine bone morphogenetic protein serine threonine kinase type I receptor (ALK-3) .
Author Wu,X., Robinson,C.E., Fong,H.W. and Gimble,J.M.
Journal J. Cell. Physiol. 168 (2), 453-461 (1996)
Title Bone morphogenetic protein type IB receptor is progressively expressed in malignant glioma tumours .
Author Yamada,N., Kato,M., ten Dijke,P., Yamashita,H., Sampath,T.K., Heldin,C.H., Miyazono,K. and Funa,K.
Journal Br. J. Cancer 73 (5), 624-629 (1996)
Title A mammalian serine/threonine kinase receptor specifically binds BMP-2 and BMP-4 .
Author Yamaji,N., Celeste,A.J., Thies,R.S., Song,J.J., Bernier,S.M., Goltzman,D., Lyons,K.M., Nove,J., Rosen,V. and Wozney,J.M.
Journal Biochem. Biophys. Res. Commun. 205 (3), 1944-1951 (1994)
Title Characterization of type I receptors for transforming growth factor-beta and activin .
Author ten Dijke,P., Yamashita,H., Ichijo,H., Franzen,P., Laiho,M., Miyazono,K. and Heldin,C.H.
Journal Science 264 (5155), 101-104 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.