• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 7, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001203251 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 7, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_001203251.1, 322303719
Length 5631 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 7, mRNA.
Product microtubule-associated protein tau isoform 7
Comment

Summary: This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (7) lacks four internal coding exons, as compared to variant 6. The reading frame is not affected, and the resulting isoform (7) has identical N- and C-termini but lacks four segments, as compared to isoform 6.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001190180.1
CDS 323..1468
Misc Feature(1)314..316
Misc Feature(2)962..1057
Misc Feature(3)962..1057
Misc Feature(4)1058..1150
Misc Feature(5)1151..1246
Exon (1)1..305
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Exon (2)306..455
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Exon (3)456..542
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Exon (4)543..608
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Exon (5)609..664
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Exon (6)665..791
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Exon (7)792..1057
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Exon (8)1058..1139
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Exon (9)1140..1252
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Exon (10)1253..5631
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Translation MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG SETSDAKSTPTAEAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKT KIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSR SRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQ PGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNI THVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV DSPQLATLADEVSASLAKQGL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
38+dbSNP:
38+a, gdbSNP:11575895
190+a, cdbSNP:62056779
279+, cdbSNP:144722105
310+dbSNP:
310+a, gdbSNP:17650901
336+a, g, tdbSNP:63750959
365+a, gdbSNP:143210139
372+c, tdbSNP:144611688
376+c, tdbSNP:63750811
385+g, tdbSNP:200084740
391+c, gdbSNP:193920967
404+a, gdbSNP:186536533
422+g, tdbSNP:193920968
431+a, gdbSNP:146476223
439+a, gdbSNP:63750529
442+c, tdbSNP:191362093
443+a, gdbSNP:115239819
498+dbSNP:
498+c, tdbSNP:143138715
546+dbSNP:
546+a, cdbSNP:149638984
555+a, g, tdbSNP:144397565
588+c, gdbSNP:139796158
595+c, tdbSNP:141556635
598+c, tdbSNP:202000892
612+dbSNP:
612+a, gdbSNP:200710643
621+a, gdbSNP:201458656
666+dbSNP:
666+a, gdbSNP:116231676
672+a, tdbSNP:147831308
677+, adbSNP:149775312
682+a, gdbSNP:139748238
687+c, tdbSNP:114635790
689+a, gdbSNP:143624519
697+a, gdbSNP:201046056
698+c, tdbSNP:141545558
735+a, gdbSNP:150420625
751+a, gdbSNP:200154181
763+a, g, tdbSNP:1052551
767+a, gdbSNP:63750612
816+dbSNP:
816+a, gdbSNP:143334682
835+c, tdbSNP:201057449
860+c, tdbSNP:138984221
861+a, gdbSNP:115492908
874+a, gdbSNP:201157234
913+a, gdbSNP:114900761
916+a, gdbSNP:1052553
937+a, gdbSNP:1801263
940+a, gdbSNP:115142761
943+a, gdbSNP:145897970
950+a, gdbSNP:63750096
971..972+, cdbSNP:35960144
997+a, gdbSNP:141636979
1000+c, tdbSNP:17652121
1005+a, cdbSNP:63750129
1013+a, gdbSNP:63751249
1015..1016+, gdbSNP:35128093
1031+c, gdbSNP:63750349
1045+a, gdbSNP:11568305
1050+g, tdbSNP:63750376
1086+dbSNP:
1086+g, tdbSNP:63749855
1087+a, gdbSNP:63751231
1092+a, tdbSNP:63750092
1101+c, tdbSNP:63750635
1120+c, gdbSNP:147220818
1145+dbSNP:
1145+a, gdbSNP:63750095
1146+g, tdbSNP:63750905
1149+a, gdbSNP:63750573
1151+a, gdbSNP:63750570
1167+a, tdbSNP:63750711
1174+c, tdbSNP:1801264
1197+c, tdbSNP:63750425
1229+a, gdbSNP:63750869
1237+c, tdbSNP:148501218
1248+a, tdbSNP:63751264
1307+dbSNP:
1307+a, c, gdbSNP:63750512
1315+a, gdbSNP:142776675
1318+c, tdbSNP:151046349
1351+a, gdbSNP:116567476
1358+c, tdbSNP:63750424
1372+c, tdbSNP:115381139
1411+c, gdbSNP:140985540
1412+a, cdbSNP:63750191
1417+c, tdbSNP:200637464
1422+c, tdbSNP:63750991
1432+c, tdbSNP:114838482
1494+c, tdbSNP:9468
1544+a, gdbSNP:73317038
1705..1706+, tdbSNP:147091683
1707..1708+, tdbSNP:66615937
1709..1710+, a, tdbSNP:55661512
1710+a, tdbSNP:3209489
1780..1781+, cdbSNP:147268270
1781..1782+, cdbSNP:67033805
1785..1786+, c, gdbSNP:55658521
1802+a, gdbSNP:8712
1932+a, gdbSNP:17574005
2031+, gdbSNP:145988937
2200+a, cdbSNP:189413478
2318+a, cdbSNP:191946476
2374..2375+, ctdbSNP:141412361
2374+c, tdbSNP:113598111
2375..2376+, ag, ctdbSNP:67148344
2375..2376+, ctdbSNP:67159445
2378..2379+, ctdbSNP:56289286
2415+a, tdbSNP:147373064
2426..2427+, cdbSNP:34662813
2515+c, tdbSNP:113815715
2535+c, tdbSNP:1052587
2569+a, gdbSNP:1052590
2613..2614+c, tdbSNP:151339764
2613..2614+, tdbSNP:5820605
2613+, a, tdbSNP:79400568
2620+c, gdbSNP:1052594
2665+c, tdbSNP:184369452
2673..2674+, ca, tgdbSNP:67759530
2674..2675+, acdbSNP:66561280
2677+a, cdbSNP:111543726
2796+a, cdbSNP:17574040
2857+a, tdbSNP:139609714
2858+a, cdbSNP:145018187
2864+c, tdbSNP:16940799
2896+c, gdbSNP:201566313
2933+c, tdbSNP:189665411
3047+c, tdbSNP:181453864
3071+a, cdbSNP:62062298
3122+c, tdbSNP:144898575
3189+c, tdbSNP:186042163
3224+, tdbSNP:113753459
3227+c, tdbSNP:7687
3376..3377+, agdbSNP:77062014
3377..3378+, ag, ctdbSNP:71760839
3377+a, tdbSNP:76290858
3385+a, gdbSNP:201038763
3386..3387+, adbSNP:67726929
3403+a, gdbSNP:76165145
3405+a, gdbSNP:62062299
3547+c, tdbSNP:17652748
3635+a, gdbSNP:16940802
3737+g, tdbSNP:73317039
3756+a, gdbSNP:75010486
3757+c, tdbSNP:16940806
3858..3859+, a, tdbSNP:35134656
3859..3860+, tdbSNP:67339139
3860+g, tdbSNP:200460037
4092+a, cdbSNP:189302708
4110+c, tdbSNP:142983115
4210+, c, gdbSNP:5820606
4211+, c, gdbSNP:66905813
4258+g, tdbSNP:151125304
4274+g, tdbSNP:2158257
4278+c, tdbSNP:2158256
4340..4342+, ttcdbSNP:199706121
4341..4342+, tcdbSNP:35363735
4342..4344+, c, ctc, gagdbSNP:35654420
4344..4346+, agg, cctdbSNP:66548930
4424+c, tdbSNP:181844055
4440+c, tdbSNP:17574228
4459+c, tdbSNP:141337757
4508..4510+, aag, cttdbSNP:67656733
4508..4510+, cttdbSNP:67507803
4527..4528+, gdbSNP:34370091
4542..4543+, gdbSNP:35853889
4542+, gdbSNP:200220784
4544..4545+, gdbSNP:11331969
4544+, gdbSNP:144839952
4547..4548+c, gdbSNP:75874344
4596+a, gdbSNP:186336286
4601+a, gdbSNP:191084195
4623+c, tdbSNP:182874630
4903+c, tdbSNP:186977284
4914+c, tdbSNP:145133090
4915+a, gdbSNP:191391284
4967+a, gdbSNP:113675257
5029..5030+, tccdbSNP:112098351
5106+g, tdbSNP:187783806
5139+c, tdbSNP:111801103
5161+a, gdbSNP:115581014
5162+c, tdbSNP:182255334
5278+a, gdbSNP:140613804
5316+a, gdbSNP:114213384
5326+a, gdbSNP:7521
5391+c, tdbSNP:111363688
5589+c, tdbSNP:192503106
Gene SymbolMAPT
Gene SynonymDDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; TAU
Chromosome17
Locus Map17q21.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001123066 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 6, mRNA. On-demand $899.00 20
NM_001123067 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 5, mRNA. In-stock $418.00 $369.00 10
NM_001203251 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 7, mRNA. In-stock $418.00 $369.00 10
NM_001203252 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 8, mRNA. In-stock $418.00 $369.00 10
NM_005910 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 2, mRNA. In-stock $509.00 $460.00 12
NM_016834 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 3, mRNA. In-stock $418.00 $369.00 10
NM_016835 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 1, mRNA. On-demand $849.00 20
NM_016841 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 4, mRNA. In-stock $418.00 $369.00 10
Title Curcumin suppresses soluble tau dimers and corrects molecular chaperone, synaptic, and behavioral deficits in aged human tau transgenic mice .
Author Ma,Q.L., Zuo,X., Yang,F., Ubeda,O.J., Gant,D.J., Alaverdyan,M., Teng,E., Hu,S., Chen,P.P., Maiti,P., Teter,B., Cole,G.M. and Frautschy,S.A.
Journal J. Biol. Chem. 288 (6), 4056-4065 (2013)
Title The fuzzy coat of pathological human Tau fibrils is a two-layered polyelectrolyte brush .
Author Wegmann,S., Medalsy,I.D., Mandelkow,E. and Muller,D.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (4), E313-E321 (2013)
Title Tau oligomers impair artificial membrane integrity and cellular viability .
Author Flach,K., Hilbrich,I., Schiffmann,A., Gartner,U., Kruger,M., Leonhardt,M., Waschipky,H., Wick,L., Arendt,T. and Holzer,M.
Journal J. Biol. Chem. 287 (52), 43223-43233 (2012)
Title Extracellular Tau levels are influenced by variability in Tau that is associated with tauopathies .
Author Karch,C.M., Jeng,A.T. and Goate,A.M.
Journal J. Biol. Chem. 287 (51), 42751-42762 (2012)
Title FTDP-17 tau mutations induce distinct effects on aggregation and microtubule interactions .
Author Combs,B. and Gamblin,T.C.
Journal Biochemistry 51 (43), 8597-8607 (2012)
Title Structure and novel exons of the human tau gene .
Author Andreadis,A., Brown,W.M. and Kosik,K.S.
Journal Biochemistry 31 (43), 10626-10633 (1992)
Title p42 MAP kinase phosphorylation sites in microtubule-associated protein tau are dephosphorylated by protein phosphatase 2A1. Implications for Alzheimer's disease [corrected] .
Author Goedert,M., Cohen,E.S., Jakes,R. and Cohen,P.
Journal FEBS Lett. 312 (1), 95-99 (1992)
Title Suppression of MAP2 in cultured cerebellar macroneurons inhibits minor neurite formation .
Author Caceres,A., Mautino,J. and Kosik,K.S.
Journal Neuron 9 (4), 607-618 (1992)
Title A protein factor essential for microtubule assembly .
Author Weingarten,M.D., Lockwood,A.H., Hwo,S.Y. and Kirschner,M.W.
Journal Proc. Natl. Acad. Sci. U.S.A. 72 (5), 1858-1862 (1975)
Title Proceedings: Aneurysmal bone cysts of the spine .
Author Ameli,N.O., Teymoorian,G.A., Saleh,H. and Slamdoost,A.
Journal Acta Neurochir (Wien) 31 (3-4), 273 (1975)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.