• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 7, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu54927 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 7, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu54927C Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 7, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001203251.1, 322303719
Length 1146 bp
Structure linear
Update Date 14-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 7, mRNA.
Product microtubule-associated protein tau isoform 7
Comment

Summary: This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (7) lacks four internal coding exons, as compared to variant 6. The reading frame is not affected, and the resulting isoform (7) has identical N- and C-termini but lacks four segments, as compared to isoform 6.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001190180.1
CDS 323..1468
Misc Feature(1)314..316
Misc Feature(2)962..1057
Misc Feature(3)962..1057
Misc Feature(4)1058..1150
Misc Feature(5)1151..1246
Exon (1)1..305
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Exon (2)306..455
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Exon (3)456..542
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Exon (4)543..608
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Exon (5)609..664
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Exon (6)665..791
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Exon (7)792..1057
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Exon (8)1058..1139
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Exon (9)1140..1252
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Exon (10)1253..5631
Gene:MAPT
Gene Synonym:DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Translation MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG SETSDAKSTPTAEAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKT KIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSR SRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQ PGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNI THVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV DSPQLATLADEVSASLAKQGL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
38+dbSNP:
38+a, gdbSNP:11575895
190+a, cdbSNP:62056779
239+a, gdbSNP:374878846
310+dbSNP:
310+a, gdbSNP:17650901
336+a, g, tdbSNP:63750959
358+a, gdbSNP:375852870
365+a, gdbSNP:143210139
372+c, tdbSNP:144611688
373+a, gdbSNP:369969350
376+c, tdbSNP:63750811
385+g, tdbSNP:200084740
391+c, gdbSNP:193920967
404+a, gdbSNP:186536533
411+c, tdbSNP:374996228
422+g, tdbSNP:193920968
431+a, gdbSNP:146476223
438+c, tdbSNP:372017279
439+a, gdbSNP:63750529
442+c, tdbSNP:191362093
443+a, gdbSNP:115239819
498+dbSNP:
498+c, tdbSNP:143138715
499+a, gdbSNP:370131551
555+dbSNP:
555+a, g, tdbSNP:144397565
558+c, tdbSNP:372299656
584+a, gdbSNP:373705830
588+c, gdbSNP:139796158
595+c, tdbSNP:141556635
598+c, tdbSNP:202000892
612+dbSNP:
612+a, gdbSNP:200710643
621+a, gdbSNP:201458656
634+c, tdbSNP:371173110
666+dbSNP:
666+a, gdbSNP:116231676
667+g, tdbSNP:368785842
677+, adbSNP:149775312
682+a, gdbSNP:139748238
687+c, tdbSNP:114635790
689+a, gdbSNP:143624519
697+a, gdbSNP:201046056
698+c, tdbSNP:141545558
735+a, gdbSNP:150420625
738+a, cdbSNP:374523783
751+a, gdbSNP:200154181
763+a, g, tdbSNP:1052551
767+a, gdbSNP:63750612
796+dbSNP:
796+a, gdbSNP:369396122
816+a, gdbSNP:143334682
835+c, tdbSNP:201057449
860+c, tdbSNP:138984221
861+a, gdbSNP:115492908
874+a, gdbSNP:201157234
896+c, tdbSNP:374286863
913+a, gdbSNP:114900761
916+a, gdbSNP:1052553
937+a, gdbSNP:1801263
940+a, gdbSNP:115142761
943+a, gdbSNP:145897970
949+c, tdbSNP:372356754
950+a, gdbSNP:63750096
971..972+, cdbSNP:35960144
977+a, gdbSNP:369217369
997+a, gdbSNP:141636979
1000+c, tdbSNP:17652121
1005+a, cdbSNP:63750129
1013+a, gdbSNP:63751249
1015..1016+, gdbSNP:35128093
1031+c, gdbSNP:63750349
1033+a, gdbSNP:373081497
1045+a, gdbSNP:11568305
1050+g, tdbSNP:63750376
1086+dbSNP:
1086+g, tdbSNP:63749855
1087+a, gdbSNP:63751231
1092+a, tdbSNP:63750092
1101+c, tdbSNP:63750635
1120+c, gdbSNP:147220818
1145+dbSNP:
1145+a, gdbSNP:63750095
1146+g, tdbSNP:63750905
1149+a, gdbSNP:63750573
1151+a, gdbSNP:63750570
1167+a, tdbSNP:63750711
1174+c, tdbSNP:1801264
1197+c, tdbSNP:63750425
1229+a, gdbSNP:63750869
1237+c, tdbSNP:148501218
1248+a, tdbSNP:63751264
1279+dbSNP:
1279+c, tdbSNP:373462041
1306+c, tdbSNP:377084749
1307+a, c, gdbSNP:63750512
1315+a, gdbSNP:142776675
1318+c, tdbSNP:151046349
1330+a, gdbSNP:377720312
1351+a, gdbSNP:116567476
1358+c, tdbSNP:63750424
1372+c, tdbSNP:115381139
1411+c, gdbSNP:140985540
1412+a, cdbSNP:63750191
1417+c, tdbSNP:200637464
1422+c, tdbSNP:63750991
1423+a, gdbSNP:369954009
1432+c, tdbSNP:114838482
1459+a, gdbSNP:370771794
1483+c, tdbSNP:373064273
1484+a, gdbSNP:377361287
1492+a, gdbSNP:370245163
1494+c, tdbSNP:9468
1511..1512+, gadbSNP:368650500
1517+a, gdbSNP:367621316
1528+a, gdbSNP:368067328
1544+a, gdbSNP:73317038
1705..1706+, tdbSNP:147091683
1707..1708+, tdbSNP:372544377
1709..1710+, a, tdbSNP:55661512
1710+a, tdbSNP:3209489
1780..1781+, cdbSNP:147268270
1781..1782+, cdbSNP:67033805
1785..1786+, c, gdbSNP:55658521
1798+a, tdbSNP:372320844
1802+a, gdbSNP:8712
1932+a, gdbSNP:17574005
2034+, gdbSNP:145988937
2200+a, cdbSNP:189413478
2318+a, cdbSNP:191946476
2374..2375+, ctdbSNP:141412361
2374+c, tdbSNP:113598111
2415+a, tdbSNP:147373064
2426..2427+, cdbSNP:34662813
2515+c, tdbSNP:113815715
2535+c, tdbSNP:1052587
2569+a, gdbSNP:1052590
2613..2614+c, tdbSNP:151339764
2613..2614+, tdbSNP:5820605
2613+, a, tdbSNP:79400568
2614..2615+, tdbSNP:373857337
2620+c, gdbSNP:1052594
2665+c, tdbSNP:184369452
2677+a, cdbSNP:111543726
2745+g, tdbSNP:367575591
2796+a, cdbSNP:17574040
2857+a, tdbSNP:139609714
2858+a, cdbSNP:145018187
2864+c, tdbSNP:16940799
2896+c, gdbSNP:201566313
2933+c, tdbSNP:189665411
3047+c, tdbSNP:181453864
3071+a, cdbSNP:62062298
complement(3122)-t, cdbSNP:144898575
3189+c, tdbSNP:186042163
3224+, tdbSNP:113753459
3227+c, tdbSNP:7687
3331..3332+, gttdbSNP:368819656
3376..3377+, agdbSNP:77062014
3377..3378+, ag, ctdbSNP:71760839
3377+a, tdbSNP:76290858
3385+a, gdbSNP:201038763
3405+a, gdbSNP:62062299
3428+a, gdbSNP:372196788
3472+c, tdbSNP:373083685
3547+c, tdbSNP:17652748
3617+c, gdbSNP:369881156
3635+a, gdbSNP:16940802
3729..3730+, tcdbSNP:377571070
3737+g, tdbSNP:73317039
complement(3756)-g, adbSNP:75010486
complement(3757)-t, g, c, adbSNP:16940806
3859..3860+, tdbSNP:67339139
3860+g, tdbSNP:200460037
3930+c, tdbSNP:373771476
4082..4083+, catdbSNP:375986662
4092+a, cdbSNP:189302708
4110+c, tdbSNP:142983115
4211+, cdbSNP:66905813
4258+g, tdbSNP:151125304
complement(4274)-t, gdbSNP:2158257
complement(4278)-t, cdbSNP:2158256
4340..4342+, ttcdbSNP:199706121
4344..4346+, agg, cctdbSNP:66548930
4424+c, tdbSNP:181844055
4426..4427+, caadbSNP:376146835
4431..4432+, acadbSNP:368323933
4440+c, tdbSNP:17574228
complement(4459)-t, cdbSNP:141337757
4527..4528+, gdbSNP:34370091
4542+, gdbSNP:200220784
4543..4544+, gdbSNP:35853889
4545..4546+, gdbSNP:374041877
4596+a, gdbSNP:186336286
4601+a, gdbSNP:191084195
4623+c, tdbSNP:182874630
4903+c, tdbSNP:186977284
4914+c, tdbSNP:145133090
4915+a, gdbSNP:191391284
4967+a, gdbSNP:113675257
5029..5030+, tccdbSNP:112098351
5106+g, tdbSNP:187783806
5139+c, tdbSNP:111801103
5161+a, gdbSNP:115581014
5162+c, tdbSNP:182255334
5278+a, gdbSNP:140613804
5314..5315+, atcdbSNP:374643022
5316+a, gdbSNP:114213384
5326+a, gdbSNP:7521
5391+c, tdbSNP:111363688
5419+a, gdbSNP:368485438
5525..5528+, ttctdbSNP:369872234
5589+c, tdbSNP:192503106
5622+c, tdbSNP:377535401
Gene SymbolMAPT
Gene SynonymDDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU
Chromosome17
Locus Map17q21.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001203251 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 7, mRNA. In-stock $99.00 5-7
NM_016835 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_016841 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 4, mRNA. In-stock $99.00 5-7
NM_005910 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 2, mRNA. In-stock $99.00 5-7
NM_016834 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 3, mRNA. In-stock $99.00 5-7
NM_001203252 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 8, mRNA. In-stock $99.00 5-7
NM_001123067 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_001123066 Homo sapiens microtubule-associated protein tau (MAPT), transcript variant 6, mRNA. On-demand $279.00 12-14
XM_005257362 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X1, mRNA. On-demand $279.00 12-14
XM_005257364 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X3, mRNA. On-demand $279.00 12-14
XM_005257365 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X4, mRNA. On-demand $279.00 12-14
XM_005257366 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X5, mRNA. On-demand $279.00 12-14
XM_005257367 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X6, mRNA. On-demand $279.00 12-14
XM_005257368 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X7, mRNA. On-demand $279.00 12-14
XM_005257369 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X8, mRNA. On-demand $219.00 7-9
XM_005257370 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X9, mRNA. On-demand $219.00 7-9
XM_005257371 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X10, mRNA. On-demand $219.00 7-9
XM_006725265 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X4, mRNA. On-demand $279.00 12-14
XM_006725266 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X5, mRNA. On-demand $279.00 12-14
XM_006725267 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X6, mRNA. On-demand $279.00 12-14
XM_006725268 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X7, mRNA. On-demand $279.00 12-14
XM_006725269 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X8, mRNA. On-demand $279.00 12-14
XM_005275647 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X2, mRNA. On-demand $219.00 7-9
XM_006725270 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X9, mRNA. On-demand $219.00 7-9
XM_006725271 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X10, mRNA. On-demand $219.00 7-9
XM_006725272 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X11, mRNA. On-demand $219.00 7-9
XM_006725273 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X12, mRNA. On-demand $219.00 7-9
XM_005275648 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X3, mRNA. On-demand $219.00 7-9
XM_006725274 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X13, mRNA. On-demand $219.00 7-9
XM_006725275 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X14, mRNA. On-demand $219.00 7-9
XM_006725616 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X12, mRNA. On-demand $279.00 12-14
XM_006725617 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X13, mRNA. On-demand $279.00 12-14
XM_006725618 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X14, mRNA. On-demand $279.00 12-14
XM_006725619 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X15, mRNA. On-demand $279.00 12-14
XM_006725620 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X16, mRNA. On-demand $279.00 12-14
XM_006725621 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X17, mRNA. On-demand $279.00 12-14
XM_006725622 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X18, mRNA. On-demand $219.00 7-9
XM_006725623 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X19, mRNA. On-demand $219.00 7-9
XM_006725624 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X20, mRNA. On-demand $219.00 7-9
XM_005257372 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X11, mRNA. On-demand $219.00 7-9
XM_006725625 PREDICTED: Homo sapiens microtubule-associated protein tau (MAPT), transcript variant X21, mRNA. On-demand $159.00 7-9
Title A functional fragment of Tau forms fibers without the need for an intermolecular cysteine bridge .
Author Huvent I, Kamah A, Cantrelle FX, Barois N, Slomianny C, Smet-Nocca C, Landrieu I and Lippens G.
Journal Biochem. Biophys. Res. Commun. 445 (2), 299-303 (2014)
Title Tau promotes neurodegeneration through global chromatin relaxation .
Author Frost B, Hemberg M, Lewis J and Feany MB.
Journal Nat. Neurosci. 17 (3), 357-366 (2014)
Title Annonacin, a natural lipophilic mitochondrial complex I inhibitor, increases phosphorylation of tau in the brain of FTDP-17 transgenic mice .
Author Yamada ES, Respondek G, Mussner S, de Andrade A, Hollerhage M, Depienne C, Rastetter A, Tarze A, Friguet B, Salama M, Champy P, Oertel WH and Hoglinger GU.
Journal Exp. Neurol. 253, 113-125 (2014)
Title Hsp90-Tau complex reveals molecular basis for specificity in chaperone action .
Author Karagoz GE, Duarte AM, Akoury E, Ippel H, Biernat J, Moran Luengo T, Radli M, Didenko T, Nordhues BA, Veprintsev DB, Dickey CA, Mandelkow E, Zweckstetter M, Boelens R, Madl T and Rudiger SG.
Journal Cell 156 (5), 963-974 (2014)
Title Difference in fibril core stability between two tau four-repeat domain proteins: a hydrogen-deuterium exchange coupled to mass spectrometry study .
Author Ramachandran G and Udgaonkar JB.
Journal Biochemistry 52 (49), 8787-8789 (2013)
Title MAPT-Related Disorders .
Author van Swieten,J.C., Rosso,S.M. and Heutink,P.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title p42 MAP kinase phosphorylation sites in microtubule-associated protein tau are dephosphorylated by protein phosphatase 2A1. Implications for Alzheimer's disease [corrected] .
Author Goedert M, Cohen ES, Jakes R and Cohen P.
Journal FEBS Lett. 312 (1), 95-99 (1992)
Title Suppression of MAP2 in cultured cerebellar macroneurons inhibits minor neurite formation .
Author Caceres A, Mautino J and Kosik KS.
Journal Neuron 9 (4), 607-618 (1992)
Title A protein factor essential for microtubule assembly .
Author Weingarten,M.D., Lockwood,A.H., Hwo,S.Y. and Kirschner,M.W.
Journal Proc. Natl. Acad. Sci. U.S.A. 72 (5), 1858-1862 (1975)
Title Proceedings: Aneurysmal bone cysts of the spine .
Author Ameli,N.O., Teymoorian,G.A., Saleh,H. and Slamdoost,A.
Journal Acta Neurochir (Wien) 31 (3-4), 273 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.