• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 14, mRNA.


RefSeq Accession Definition Services Price Order
NM_001204290 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 14, mRNA. ORF Sequence $189.66
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001204290.1, 324120965
Length 1052 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 14, mRNA.
Product mucin-1 isoform 14 precursor
Comment

Summary: This gene encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is known to contain a highly polymorphic variable number tandem repeats (VNTR) domain. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2011].


Transcript Variant: This variant (14) has multiple differences but maintains the reading frame, compared to variant 1. The encoded isoform (14) is shorter than isoform 1.

RefSeq NP_001191219.1
CDS 73..726
Misc Feature(1)<196..414
Exon (1)1..130
Gene:MUC1
Gene Synonym:CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (2)131..195
Gene:MUC1
Gene Synonym:CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (3)196..242
Gene:MUC1
Gene Synonym:CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (4)243..379
Gene:MUC1
Gene Synonym:CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (5)380..501
Gene:MUC1
Gene Synonym:CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (6)502..651
Gene:MUC1
Gene Synonym:CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (7)652..1037
Gene:MUC1
Gene Synonym:CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Translation MTPGTQSPFFLLLLLTVLTGGEKETSATQRSSVPSSTEKNAIYKQGGFLGLSNIKFRPGS VVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG WGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRY VPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(2)-dbSNP:
complement(2)-g, adbSNP:11465204
complement(134)-dbSNP:
complement(134)-t, cdbSNP:201761107
complement(146)-g, adbSNP:201186912
complement(156)-g, cdbSNP:199568358
complement(177)-t, g, adbSNP:145691584
complement(180)-g, adbSNP:200478078
complement(210)-dbSNP:
complement(210)-t, cdbSNP:140871200
complement(248)-dbSNP:
complement(248)-c, adbSNP:145224844
complement(264)-t, cdbSNP:139620330
complement(304)-c, adbSNP:144273480
complement(307)-t, g, adbSNP:1611770
complement(323)-t, cdbSNP:200411609
complement(324)-t, adbSNP:41264913
complement(362)-g, adbSNP:146141676
complement(363)-t, cdbSNP:201798179
complement(379)-t, cdbSNP:201815857
complement(383)-dbSNP:
complement(383)-g, adbSNP:11465207
complement(413)-g, cdbSNP:199840128
complement(473)-g, adbSNP:200788986
complement(477)-c, adbSNP:141460657
complement(488)-t, cdbSNP:183700327
complement(500)-g, adbSNP:199768496
complement(579)-dbSNP:
complement(579)-g, cdbSNP:200639498
complement(635)-c, adbSNP:191544901
complement(644)-t, cdbSNP:148332231
complement(680)-dbSNP:
complement(680)-g, adbSNP:147669350
complement(687)-t, cdbSNP:11465209
complement(703)-g, cdbSNP:199968990
complement(732)-t, cdbSNP:1611772
complement(736)-t, cdbSNP:139043100
complement(805)-t, cdbSNP:1611773
complement(923)-g, adbSNP:11465210
complement(958)-t, adbSNP:188749315
complement(992)-c, adbSNP:112893627
Gene SymbolMUC1
Gene SynonymCA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Chromosome1
Locus Map1q21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001018016 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 2, mRNA. Full Length $345.97
ORF Sequence $230.55
NM_001018017 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 3, mRNA. Full Length $338.14
ORF Sequence $222.72
NM_001044390 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 5, mRNA. Full Length $292.90
ORF Sequence $177.48
NM_001044391 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 6, mRNA. Full Length $246.79
ORF Sequence $159.00
NM_001044392 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 7, mRNA. Full Length $254.62
ORF Sequence $159.00
NM_001044393 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 8, mRNA. Full Length $283.62
ORF Sequence $159.00
NM_001204285 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 9, mRNA. Full Length $529.54
ORF Sequence $414.12
NM_001204286 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 10, mRNA. Full Length $537.37
ORF Sequence $421.95
NM_001204287 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 11, mRNA. Full Length $361.63
ORF Sequence $246.21
NM_001204288 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 12, mRNA. Full Length $336.69
ORF Sequence $191.40
NM_001204289 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 13, mRNA. Full Length $323.35
ORF Sequence $207.93
NM_001204290 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 14, mRNA. Full Length $305.08
ORF Sequence $189.66
NM_001204291 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 15, mRNA. Full Length $325.96
ORF Sequence $210.54
NM_001204292 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 16, mRNA. Full Length $324.22
ORF Sequence $208.80
NM_001204293 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 17, mRNA. Full Length $318.42
ORF Sequence $173.13
NM_001204294 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 18, mRNA. Full Length $316.39
ORF Sequence $200.97
NM_001204295 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 19, mRNA. Full Length $280.72
ORF Sequence $165.30
NM_001204296 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 20, mRNA. Full Length $300.73
ORF Sequence $185.31
NM_001204297 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 21, mRNA. Full Length $270.28
ORF Sequence $159.00
NM_002456 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 1, mRNA. Full Length $353.80
ORF Sequence $238.38
Title [Differences of the regulation on the expression of mucin 1 induced by two single-strand RNA viruses, respiratory syncytial virus and influenza virus] .
Author Lu,X., Ni,S.Y. and Li,Y.S.
Journal Bing Du Xue Bao 28 (6), 639-644 (2012)
Title A novel protein derived from the MUC1 gene by alternative splicing and frameshifting .
Author Levitin,F., Baruch,A., Weiss,M., Stiegman,K., Hartmann,M.L., Yoeli-Lerner,M., Ziv,R., Zrihan-Licht,S., Shina,S., Gat,A., Lifschitz,B., Simha,M., Stadler,Y., Cholostoy,A., Gil,B., Greaves,D., Keydar,I., Zaretsky,J., Smorodinsky,N. and Wreschner,D.H.
Journal J. Biol. Chem. 280 (11), 10655-10663 (2005)
Title Identification of MUC1 proteolytic cleavage sites in vivo .
Author Parry,S., Silverman,H.S., McDermott,K., Willis,A., Hollingsworth,M.A. and Harris,A.
Journal Biochem. Biophys. Res. Commun. 283 (3), 715-720 (2001)
Title Characterization and molecular cloning of a novel MUC1 protein, devoid of tandem repeats, expressed in human breast cancer tissue .
Author Zrihan-Licht,S., Vos,H.L., Baruch,A., Elroy-Stein,O., Sagiv,D., Keydar,I., Hilkens,J. and Wreschner,D.H.
Journal Eur. J. Biochem. 224 (2), 787-795 (1994)
Title Cell-associated episialin is a complex containing two proteins derived from a common precursor .
Author Ligtenberg,M.J., Kruijshaar,L., Buijs,F., van Meijer,M., Litvinov,S.V. and Hilkens,J.
Journal J. Biol. Chem. 267 (9), 6171-6177 (1992)
Title Structure and expression of the human polymorphic epithelial mucin gene: an expressed VNTR unit .
Author Lancaster,C.A., Peat,N., Duhig,T., Wilson,D., Taylor-Papadimitriou,J. and Gendler,S.J.
Journal Biochem. Biophys. Res. Commun. 173 (3), 1019-1029 (1990)
Title Isolation and characterization of an expressed hypervariable gene coding for a breast-cancer-associated antigen .
Author Tsarfaty,I., Hareuveni,M., Horev,J., Zaretsky,J., Weiss,M., Jeltsch,J.M., Garnier,J.M., Lathe,R., Keydar,I. and Wreschner,D.H.
Journal Gene 93 (2), 313-318 (1990)
Title Cloning and sequencing of a human pancreatic tumor mucin cDNA .
Author Lan,M.S., Batra,S.K., Qi,W.N., Metzgar,R.S. and Hollingsworth,M.A.
Journal J. Biol. Chem. 265 (25), 15294-15299 (1990)
Title Molecular cloning and expression of human tumor-associated polymorphic epithelial mucin .
Author Gendler,S.J., Lancaster,C.A., Taylor-Papadimitriou,J., Duhig,T., Peat,N., Burchell,J., Pemberton,L., Lalani,E.N. and Wilson,D.
Journal J. Biol. Chem. 265 (25), 15286-15293 (1990)
Title Episialin, a carcinoma-associated mucin, is generated by a polymorphic gene encoding splice variants with alternative amino termini .
Author Ligtenberg,M.J., Vos,H.L., Gennissen,A.M. and Hilkens,J.
Journal J. Biol. Chem. 265 (10), 5573-5578 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878