• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 14, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20181 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 14, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu20181C Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 14, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001204290.1, 324120965
Length 654 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 14, mRNA.
Product mucin-1 isoform 14 precursor
Comment

Summary: This gene encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is known to contain a highly polymorphic variable number tandem repeats (VNTR) domain. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2011].


Transcript Variant: This variant (14) has multiple differences but maintains the reading frame, compared to variant 1. The encoded isoform (14) is shorter than isoform 1.

RefSeq NP_001191219.1
CDS 73..726
Misc Feature(1)<196..414
Exon (1)1..130
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (2)131..195
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (3)196..242
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (4)243..379
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (5)380..501
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (6)502..651
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (7)652..1037
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Translation MTPGTQSPFFLLLLLTVLTGGEKETSATQRSSVPSSTEKNAIYKQGGFLGLSNIKFRPGS VVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG WGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRY VPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
2+dbSNP:
2+a, gdbSNP:11465204
complement(20)-g, adbSNP:372118515
complement(24)-g, adbSNP:368256181
complement(80)-g, adbSNP:376608767
complement(81)-t, cdbSNP:373505102
complement(92)-g, cdbSNP:368800613
complement(103)-g, adbSNP:377356836
complement(134)-dbSNP:
complement(134)-t, cdbSNP:201761107
complement(146)-g, adbSNP:201186912
complement(156)-g, cdbSNP:199568358
complement(177)-t, g, adbSNP:145691584
complement(180)-g, adbSNP:200478078
complement(210)-dbSNP:
complement(210)-t, cdbSNP:140871200
complement(231)-g, adbSNP:370819310
complement(248)-dbSNP:
complement(248)-c, adbSNP:145224844
complement(250)-t, adbSNP:373382247
complement(264)-t, cdbSNP:139620330
complement(285)-t, cdbSNP:370391810
complement(304)-c, adbSNP:144273480
complement(307)-t, g, adbSNP:1611770
complement(323)-t, cdbSNP:200411609
complement(324)-t, adbSNP:41264913
complement(362)-g, adbSNP:146141676
complement(363)-t, cdbSNP:201798179
complement(379)-t, cdbSNP:201815857
complement(383)-dbSNP:
complement(383)-g, adbSNP:11465207
complement(383)-g, adbSNP:386518307
complement(413)-g, cdbSNP:199840128
complement(416)-t, cdbSNP:369649894
complement(422)-t, cdbSNP:369608212
complement(437)-, cdbSNP:371577379
complement(441)-g, adbSNP:375090196
complement(442)-t, cdbSNP:373081136
complement(473)-g, adbSNP:200788986
complement(477)-c, adbSNP:141460657
complement(488)-t, cdbSNP:183700327
complement(500)-g, adbSNP:199768496
complement(579)-dbSNP:
complement(579)-g, c, adbSNP:200639498
complement(634)-g, cdbSNP:372682991
complement(635)-c, adbSNP:191544901
complement(644)-t, cdbSNP:148332231
complement(687)-dbSNP:
complement(687)-t, cdbSNP:386518309
687+c, tdbSNP:11465209
complement(703)-g, cdbSNP:199968990
complement(732)-t, cdbSNP:1611772
complement(735)-g, adbSNP:369597551
complement(736)-t, cdbSNP:139043100
complement(805)-t, cdbSNP:1611773
complement(923)-g, adbSNP:11465210
complement(923)-g, adbSNP:386518310
complement(958)-t, adbSNP:188749315
complement(992)-c, adbSNP:112893627
Gene SymbolMUC1
Gene SynonymADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Chromosome1
Locus Map1q21
Title Genetic regulation of MUC1 expression by Helicobacter pylori in gastric cancer cells .
Author Guang W, Czinn SJ, Blanchard TG, Kim KC and Lillehoj EP.
Journal Biochem. Biophys. Res. Commun. 445 (1), 145-150 (2014)
Title A novel protein derived from the MUC1 gene by alternative splicing and frameshifting .
Author Levitin F, Baruch A, Weiss M, Stiegman K, Hartmann ML, Yoeli-Lerner M, Ziv R, Zrihan-Licht S, Shina S, Gat A, Lifschitz B, Simha M, Stadler Y, Cholostoy A, Gil B, Greaves D, Keydar I, Zaretsky J, Smorodinsky N and Wreschner DH.
Journal J. Biol. Chem. 280 (11), 10655-10663 (2005)
Title Identification of MUC1 proteolytic cleavage sites in vivo .
Author Parry S, Silverman HS, McDermott K, Willis A, Hollingsworth MA and Harris A.
Journal Biochem. Biophys. Res. Commun. 283 (3), 715-720 (2001)
Title Characterization and molecular cloning of a novel MUC1 protein, devoid of tandem repeats, expressed in human breast cancer tissue .
Author Zrihan-Licht S, Vos HL, Baruch A, Elroy-Stein O, Sagiv D, Keydar I, Hilkens J and Wreschner DH.
Journal Eur. J. Biochem. 224 (2), 787-795 (1994)
Title Medullary Cystic Kidney Disease Type 1 .
Author Bleyer,A.J. and Kmoch,S.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Structure and expression of the human polymorphic epithelial mucin gene: an expressed VNTR unit .
Author Lancaster CA, Peat N, Duhig T, Wilson D, Taylor-Papadimitriou J and Gendler SJ.
Journal Biochem. Biophys. Res. Commun. 173 (3), 1019-1029 (1990)
Title Isolation and characterization of an expressed hypervariable gene coding for a breast-cancer-associated antigen .
Author Tsarfaty I, Hareuveni M, Horev J, Zaretsky J, Weiss M, Jeltsch JM, Garnier JM, Lathe R, Keydar I and Wreschner DH.
Journal Gene 93 (2), 313-318 (1990)
Title Cloning and sequencing of a human pancreatic tumor mucin cDNA .
Author Lan MS, Batra SK, Qi WN, Metzgar RS and Hollingsworth MA.
Journal J. Biol. Chem. 265 (25), 15294-15299 (1990)
Title Molecular cloning and expression of human tumor-associated polymorphic epithelial mucin .
Author Gendler SJ, Lancaster CA, Taylor-Papadimitriou J, Duhig T, Peat N, Burchell J, Pemberton L, Lalani EN and Wilson D.
Journal J. Biol. Chem. 265 (25), 15286-15293 (1990)
Title Episialin, a carcinoma-associated mucin, is generated by a polymorphic gene encoding splice variants with alternative amino termini .
Author Ligtenberg MJ, Vos HL, Gennissen AM and Hilkens J.
Journal J. Biol. Chem. 265 (10), 5573-5578 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.