Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA.
| RefSeq Version | NM_001243.3, 68348710 |
| Length | 3686 bp |
| Structure | linear |
| Update Date | 24-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA. |
| Product | tumor necrosis factor receptor superfamily member 8 isoform 1 precursor |
| Comment | Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). |
| RefSeq | NP_001234.2 |
| CDS | 223..2010 | Exon (1) | 1..285 | Exon (2) | 1..285 | Exon (3) | 286..373 | Exon (4) | 374..490 | Exon (5) | 491..643 | Exon (6) | 644..734 | Exon (7) | 735..898 | Exon (8) | 899..1015 | Exon (9) | 1016..1168 | Exon (10) | 1169..1262 | Exon (11) | 1263..1375 | Exon (12) | 1376..1477 | Exon (13) | 1478..1531 | Exon (14) | 1532..1557 | Exon (15) | 1558..1765 | Exon (16) | 1766..3686 |
| Translation | MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT
PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSRARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA
SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL
ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Gene Symbol | TNFRSF8 |
| Gene Synonym | CD30; D1S166E; Ki-1 |
| Chromosome | 1 |
| Locus Map | 1p36 |
| All Transcripts | NM_001243 , NM_152942 |
| Title | Soluble CD30: a serum marker for Epstein-Barr virus-associated lymphoproliferative diseases . |
| Author | Haque,T., Chaggar,T., Schafers,J., Atkinson,C., McAulay,K.A. and Crawford,D.H. |
| Journal | J. Med. Virol. 83 (2), 311-316 (2011) |
| Title | Valsartan-induced drug eruption followed by CD30+ pseudolymphomatous eruption . |
| Author | Sawada,Y., Yoshiki,R., Kawakami,C., Fukamachi,S., Sugita,K., Nakamura,M. and Tokura,Y. |
| Journal | Acta Derm. Venereol. 90 (5), 521-522 (2010) |
| Title | CD30 discriminates heat shock protein 60-induced FOXP3+ CD4+ T cells with a regulatory phenotype . |
| Author | de Kleer,I., Vercoulen,Y., Klein,M., Meerding,J., Albani,S., van der Zee,R., Sawitzki,B., Hamann,A., Kuis,W. and Prakken,B. |
| Journal | J. Immunol. 185 (4), 2071-2079 (2010) |
| Title | A prospective study of serum soluble CD30 in allogeneic hematopoietic stem cell transplantation . |
| Author | Hubel,K., Cremer,B., Heuser,E., von Strandmann,E.P., Hallek,M. and Hansen,H.P. |
| Journal | Transpl. Immunol. 23 (4), 215-219 (2010) |
| Title | Increased expression of ganglioside GM1 in peripheral CD4+ T cells correlates soluble form of CD30 in Systemic Lupus Erythematosus patients . |
| Author | Dong,L., Hu,S., Chen,F., Lei,X., Tu,W., Yu,Y., Yang,L., Sun,W., Yamaguchi,T., Masaki,Y. and Umehara,H. |
| Journal | J. Biomed. Biotechnol. 2010, 569053 (2010) |
| Title | Opposite effects of the CD30 ligand are not due to CD30 mutations: results from cDNA cloning and sequence comparison of the CD30 antigen from different sources . |
| Author | Jung,W., Krueger,S., Renner,C., Gause,A., Sahin,U., Trumper,L. and Pfreundschuh,M. |
| Journal | Mol. Immunol. 31 (17), 1329-1334 (1994) |
| Title | Hyperphosphorylation of a novel 80 kDa protein-tyrosine kinase similar to Ltk in a human Ki-1 lymphoma cell line, AMS3 . |
| Author | Shiota,M., Fujimoto,J., Semba,T., Satoh,H., Yamamoto,T. and Mori,S. |
| Journal | Oncogene 9 (6), 1567-1574 (1994) |
| Title | Assignment of the human CD30 (Ki-1) gene to 1p36 . |
| Author | Fonatsch,C., Latza,U., Durkop,H., Rieder,H. and Stein,H. |
| Journal | Genomics 14 (3), 825-826 (1992) |
| Title | Molecular cloning and expression of a new member of the nerve growth factor receptor family that is characteristic for Hodgkin's disease . |
| Author | Durkop,H., Latza,U., Hummel,M., Eitelbach,F., Seed,B. and Stein,H. |
| Journal | Cell 68 (3), 421-427 (1992) |
| Title | Ki-1 (CD30) antigen is released by Ki-1-positive tumor cells in vitro and in vivo. I. Partial characterization of soluble Ki-1 antigen and detection of the antigen in cell culture supernatants and in serum by an enzyme-linked immunosorbent assay . |
| Author | Josimovic-Alasevic,O., Durkop,H., Schwarting,R., Backe,E., Stein,H. and Diamantstein,T. |
| Journal | Eur. J. Immunol. 19 (1), 157-162 (1989) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |