• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001243 Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_001243.3, 68348710
Length 3686 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA.
Product tumor necrosis factor receptor superfamily member 8 isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_001234.2
CDS 223..2010
Misc Feature(1)79..81
Misc Feature(2)304..420
Misc Feature(3)349..609
Misc Feature(4)order(358..387,409..420,424..426,517..525)
Misc Feature(5)order(358..360,370..372,376..378,412..414,424..426)
Misc Feature(6)424..540
Misc Feature(7)order(442..444,466..468,496..498,562..564,595..597)
Misc Feature(8)order(451..453,463..471)
Misc Feature(9)541..672
Misc Feature(10)order(562..564,595..609)
Misc Feature(11)835..945
Misc Feature(12)895..1134
Misc Feature(13)order(895..912,937..951,1042..1050)
Misc Feature(14)order(895..897,901..903,940..942,949..951,979..981)
Misc Feature(15)949..1065
Misc Feature(16)order(967..969,1000..1002,1021..1023,1087..1089,
Misc Feature(17)order(976..981,997..1005)
Misc Feature(18)1066..1197
Misc Feature(19)order(1087..1089,1120..1134)
Misc Feature(20)1360..1443
Misc Feature(21)1576..1578
Exon (1)1..285
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (2)286..373
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (3)374..490
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (4)491..643
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (5)644..734
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (6)735..898
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (7)899..1015
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (8)1016..1168
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (9)1169..1262
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (10)1263..1375
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (11)1376..1477
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (12)1478..1531
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (13)1532..1557
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (14)1558..1765
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (15)1766..3686
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Translation MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSRARC VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
66+dbSNP:
66+g, tdbSNP:11569785
88+c, gdbSNP:34926532
203+a, cdbSNP:181035575
214+g, tdbSNP:201671441
297+dbSNP:
297+c, tdbSNP:146787215
418+dbSNP:
418+a, gdbSNP:140742107
420+a, gdbSNP:188643209
445+c, gdbSNP:145380729
492+dbSNP:
492+c, tdbSNP:2230622
493+g, tdbSNP:193921033
499+a, gdbSNP:141205943
506+a, gdbSNP:72861979
513+a, gdbSNP:144705539
540+c, tdbSNP:149306762
547+c, tdbSNP:148756853
549+a, gdbSNP:11569851
551+c, tdbSNP:141516508
553+a, gdbSNP:139967437
565+c, tdbSNP:149832538
576+c, tdbSNP:147117912
579+c, tdbSNP:147581692
592+c, tdbSNP:148280403
651+dbSNP:
651+a, gdbSNP:201745312
710+c, tdbSNP:141348765
712+a, gdbSNP:138036251
740+dbSNP:
740+a, cdbSNP:139582940
744+a, cdbSNP:149570709
779+a, cdbSNP:148809636
791+a, gdbSNP:151315213
822+c, tdbSNP:145520020
858+c, tdbSNP:142042185
876+a, gdbSNP:61760049
981+dbSNP:
981+c, tdbSNP:145457491
993+a, gdbSNP:2230623
1000+a, gdbSNP:141023619
1005+c, tdbSNP:61749274
1033+dbSNP:
1033+a, tdbSNP:141890526
1035+a, gdbSNP:114975232
1040+a, g, tdbSNP:2230624
1049+a, gdbSNP:200643752
1057+c, tdbSNP:140175552
1066+a, gdbSNP:199906292
1076+c, tdbSNP:201412076
1082+c, tdbSNP:147298360
1111+a, gdbSNP:1763642
1117+c, tdbSNP:201661836
1149+a, gdbSNP:200005472
1151+c, tdbSNP:146527504
1162+a, gdbSNP:2275170
1163+c, tdbSNP:141089207
1190+dbSNP:
1190+a, cdbSNP:148865579
1199+c, tdbSNP:200934413
1200+a, gdbSNP:11569904
1204+a, cdbSNP:141433768
1265+dbSNP:
1265+c, tdbSNP:138595447
1269+c, tdbSNP:200395175
1278+a, gdbSNP:111344887
1326+c, tdbSNP:147315841
1329+c, tdbSNP:202227728
1335+c, tdbSNP:149818180
1336+a, gdbSNP:200494344
1338+c, tdbSNP:199556801
1363+a, gdbSNP:148424672
1411+dbSNP:
1411+g, tdbSNP:146421438
1425+c, tdbSNP:201949734
1426+a, gdbSNP:2230625
1471+c, tdbSNP:140319459
1518+dbSNP:
1518+a, gdbSNP:145777016
1538+dbSNP:
1538+g, tdbSNP:59566987
1548+a, gdbSNP:11569933
1569+dbSNP:
1569+c, tdbSNP:476488
1577+c, tdbSNP:141539189
1591+c, gdbSNP:199499696
1595+c, tdbSNP:139117240
1619+a, gdbSNP:35511003
1634+a, cdbSNP:144498730
1644+c, tdbSNP:200763197
1691+c, tdbSNP:200000230
1692+g, tdbSNP:142641214
1706+c, tdbSNP:199947044
1733+a, gdbSNP:2230627
1742+c, tdbSNP:142130984
1753+a, gdbSNP:201980460
1767+dbSNP:
1767+g, tdbSNP:77721961
1788+c, tdbSNP:111313258
1800+c, tdbSNP:142351498
1826+c, tdbSNP:201106415
1883+c, tdbSNP:138958040
1977+a, cdbSNP:149429293
2045+a, gdbSNP:201551670
2146+c, tdbSNP:189861783
2210+a, gdbSNP:181501926
2222+c, tdbSNP:142860118
2253+a, gdbSNP:186933088
2314+a, gdbSNP:11569949
2359+c, tdbSNP:191772362
2376+c, tdbSNP:11121880
2580+a, gdbSNP:11569950
2605+a, cdbSNP:75100997
2617+a, gdbSNP:11569951
2668+c, gdbSNP:111829026
2707..2708+, tgggcccagggcctdbSNP:11569952
2751+c, tdbSNP:200537955
2799+c, tdbSNP:183162947
2884+a, gdbSNP:186402138
2897+a, gdbSNP:142324868
2930+c, tdbSNP:189576093
3012+c, tdbSNP:146907046
3021..3022+, cgdbSNP:202212939
3022..3023+c, gdbSNP:520311
3023+c, gdbSNP:41480747
3024..3025+, gcdbSNP:11569954
3054+a, gdbSNP:182266372
3077+a, cdbSNP:79902471
3148+a, gdbSNP:74053024
3184+c, tdbSNP:7525045
3197+c, gdbSNP:11569955
3207+a, gdbSNP:187790451
3294+c, tdbSNP:11569956
3296+c, gdbSNP:11569957
3300+a, c, g, tdbSNP:544065
3362+a, gdbSNP:192926082
3489+a, gdbSNP:183161978
3509+a, cdbSNP:201535487
3602+a, cdbSNP:11569958
3611+c, tdbSNP:188581929
Gene SymbolTNFRSF8
Gene SynonymCD30; D1S166E; Ki-1
Chromosome1
Locus Map1p36
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001243 Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA. On-demand $849.00 20
NM_152942 Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 2, mRNA. In-stock $248.00 $199.00 10
Title Assessment of different biomarkers provides valuable diagnostic standards in the evaluation of the risk of acute rejection .
Author Zheng,J., Ding,X., Tian,X., Jin,Z., Pan,X., Yan,H., Feng,X., Hou,J., Xiang,H., Ren,L., Tian,P. and Xue,W.
Journal Acta Biochim. Biophys. Sin. (Shanghai) 44 (9), 730-736 (2012)
Title A novel role for reciprocal CD30-CD30L signaling in the cross-talk between natural killer and dendritic cells .
Author Simhadri,V.L., Hansen,H.P., Simhadri,V.R., Reiners,K.S., Bessler,M., Engert,A. and von Strandmann,E.P.
Journal Biol. Chem. 393 (1-2), 101-106 (2012)
Title Tumor cell nuclear diameter and CD30 expression as potential prognostic parameter in patients with extranodal NK/T-cell lymphoma, nasal type .
Author Hong,J., Park,S., Baek,H.L., Jung,J.H., Kang,I.G., Sym,S.J., Park,J., Ahn,J.Y., Cho,E.K., Kim,S.T., Shin,D.B. and Lee,J.H.
Journal Int J Clin Exp Pathol 5 (9), 939-947 (2012)
Title Distinct motifs in the intracellular domain of human CD30 differentially activate canonical and alternative transcription factor NF-kappaB signaling .
Author Buchan,S.L. and Al-Shamkhani,A.
Journal PLoS ONE 7 (9), E45244 (2012)
Title Targeted repression of overexpressed CD30 downregulates NF-kappaB and ERK1/2 pathway in Hodgkin lymphoma cell lines .
Author Watanabe,M., Nakano,K., Togano,T., Nakashima,M., Higashihara,M., Kadin,M.E., Watanabe,T. and Horie,R.
Journal Oncol. Res. 19 (10-11), 463-469 (2011)
Title Opposite effects of the CD30 ligand are not due to CD30 mutations: results from cDNA cloning and sequence comparison of the CD30 antigen from different sources .
Author Jung,W., Krueger,S., Renner,C., Gause,A., Sahin,U., Trumper,L. and Pfreundschuh,M.
Journal Mol. Immunol. 31 (17), 1329-1334 (1994)
Title Hyperphosphorylation of a novel 80 kDa protein-tyrosine kinase similar to Ltk in a human Ki-1 lymphoma cell line, AMS3 .
Author Shiota,M., Fujimoto,J., Semba,T., Satoh,H., Yamamoto,T. and Mori,S.
Journal Oncogene 9 (6), 1567-1574 (1994)
Title Assignment of the human CD30 (Ki-1) gene to 1p36 .
Author Fonatsch,C., Latza,U., Durkop,H., Rieder,H. and Stein,H.
Journal Genomics 14 (3), 825-826 (1992)
Title Molecular cloning and expression of a new member of the nerve growth factor receptor family that is characteristic for Hodgkin's disease .
Author Durkop,H., Latza,U., Hummel,M., Eitelbach,F., Seed,B. and Stein,H.
Journal Cell 68 (3), 421-427 (1992)
Title Ki-1 (CD30) antigen is released by Ki-1-positive tumor cells in vitro and in vivo. I. Partial characterization of soluble Ki-1 antigen and detection of the antigen in cell culture supernatants and in serum by an enzyme-linked immunosorbent assay .
Author Josimovic-Alasevic,O., Durkop,H., Schwarting,R., Backe,E., Stein,H. and Diamantstein,T.
Journal Eur. J. Immunol. 19 (1), 157-162 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.