• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001243 Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_001243.4, 597709794
Length 3706 bp
Structure linear
Update Date 07-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA.
Product tumor necrosis factor receptor superfamily member 8 isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_001234.3
CDS 223..2010
Misc Feature(1)79..81
Misc Feature(2)304..420
Misc Feature(3)325..609
Misc Feature(4)order(325..327,358..360,370..372,376..378,412..414,
Misc Feature(5)order(358..387,409..420,424..426,517..525)
Misc Feature(6)424..540
Misc Feature(7)order(442..444,466..468,496..498,562..564,595..597)
Misc Feature(8)order(451..453,463..471)
Misc Feature(9)541..672
Misc Feature(10)order(562..564,595..609)
Misc Feature(11)835..945
Misc Feature(12)946..>1128
Misc Feature(13)949..1065
Misc Feature(14)1066..1197
Misc Feature(15)1360..1443
Misc Feature(16)1576..1578
Exon (1)1..285
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (2)286..373
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (3)374..490
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (4)491..643
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (5)644..734
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (6)735..898
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (7)899..1015
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (8)1016..1168
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (9)1169..1262
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (10)1263..1375
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (11)1376..1477
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (12)1478..1531
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (13)1532..1557
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (14)1558..1765
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Exon (15)1766..3686
Gene:TNFRSF8
Gene Synonym:CD30; D1S166E; Ki-1
Translation MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
66+dbSNP:
66+g, tdbSNP:11569785
88+c, gdbSNP:34926532
190+g, tdbSNP:374177592
203+a, cdbSNP:181035575
214+g, tdbSNP:201671441
240+c, tdbSNP:368369505
297+dbSNP:
297+c, tdbSNP:146787215
418+dbSNP:
418+a, gdbSNP:140742107
420+a, gdbSNP:188643209
445+c, gdbSNP:145380729
457+a, gdbSNP:371472066
474+c, tdbSNP:375856469
486+g, tdbSNP:369817280
492+dbSNP:
492+c, tdbSNP:2230622
492+c, tdbSNP:386585097
493+g, tdbSNP:193921033
499+a, gdbSNP:141205943
506+a, gdbSNP:72861979
509+c, tdbSNP:375945555
513+a, gdbSNP:144705539
540+c, tdbSNP:149306762
547+c, tdbSNP:148756853
549+a, gdbSNP:11569851
551+c, tdbSNP:141516508
553+a, gdbSNP:139967437
565+c, tdbSNP:149832538
576+c, tdbSNP:147117912
579+c, tdbSNP:147581692
585+c, tdbSNP:370479291
590+c, tdbSNP:373599810
591+c, tdbSNP:377016993
592+c, tdbSNP:148280403
617+c, tdbSNP:370304432
648+dbSNP:
648+a, gdbSNP:372348290
651+a, gdbSNP:201745312
660+c, tdbSNP:375684588
710+c, tdbSNP:141348765
712+a, gdbSNP:138036251
718+c, tdbSNP:367850226
738+dbSNP:
738+c, tdbSNP:369111395
742+a, gdbSNP:371499265
744+a, cdbSNP:149570709
779+a, cdbSNP:148809636
791+a, gdbSNP:151315213
822+c, tdbSNP:145520020
849+a, gdbSNP:376725720
858+c, tdbSNP:142042185
865+c, tdbSNP:267597959
876+a, gdbSNP:61760049
910..911+dbSNP:
910..911+, cdbSNP:368286085
942+c, tdbSNP:373306162
976+a, gdbSNP:377149878
981+c, tdbSNP:145457491
993+a, gdbSNP:2230623
999+c, tdbSNP:372079093
1000+a, gdbSNP:141023619
1005+c, tdbSNP:61749274
1033+dbSNP:
1033+a, tdbSNP:141890526
1035+a, gdbSNP:114975232
1040+a, g, tdbSNP:2230624
1049+a, gdbSNP:200643752
1057+c, tdbSNP:140175552
1066+a, gdbSNP:199906292
1076+c, tdbSNP:201412076
1082+c, tdbSNP:147298360
complement(1111)-g, adbSNP:1763642
1117+c, tdbSNP:201661836
1149+a, gdbSNP:200005472
1151+c, tdbSNP:146527504
complement(1162)-g, adbSNP:2275170
1162+c, tdbSNP:386563256
1163+c, tdbSNP:141089207
1190+dbSNP:
1190+a, cdbSNP:148865579
1199+c, tdbSNP:200934413
1200+a, gdbSNP:11569904
1249+a, gdbSNP:370973053
1254+a, gdbSNP:374404049
1265+dbSNP:
1265+c, tdbSNP:138595447
1269+c, tdbSNP:200395175
1278+a, gdbSNP:111344887
1329+c, tdbSNP:202227728
1335+c, tdbSNP:149818180
1336+a, gdbSNP:200494344
1338+c, tdbSNP:199556801
1341+g, tdbSNP:375546475
1363+a, gdbSNP:148424672
1401+dbSNP:
1401+c, gdbSNP:376461041
1406+c, tdbSNP:370905036
1411+g, tdbSNP:146421438
1425+c, tdbSNP:201949734
1426+a, gdbSNP:2230625
1448+a, gdbSNP:377407473
1471+c, tdbSNP:140319459
1518+dbSNP:
1518+a, gdbSNP:145777016
1524+a, gdbSNP:375347090
1538+dbSNP:
1538+g, tdbSNP:59566987
1548+a, gdbSNP:11569933
1569+dbSNP:
1569+c, tdbSNP:476488
1577+c, tdbSNP:141539189
1591+c, gdbSNP:199499696
1595+c, tdbSNP:139117240
1604+a, gdbSNP:371493096
1619+a, gdbSNP:35511003
1634+a, cdbSNP:144498730
1644+c, tdbSNP:200763197
1645+a, gdbSNP:376583542
1691+c, tdbSNP:200000230
1692+g, tdbSNP:142641214
1695+c, tdbSNP:370010968
1696+a, gdbSNP:373470708
1706+c, tdbSNP:199947044
1733+a, gdbSNP:2230627
1742+c, tdbSNP:142130984
1753+a, gdbSNP:201980460
complement(1767)-dbSNP:
complement(1767)-t, gdbSNP:77721961
1788+c, tdbSNP:111313258
1800+c, tdbSNP:142351498
1826+c, tdbSNP:201106415
1835+a, gdbSNP:373644324
1876+a, cdbSNP:373121136
1883+c, tdbSNP:138958040
1884+a, gdbSNP:376213546
1977+a, cdbSNP:149429293
2008+g, tdbSNP:370512108
2045+a, gdbSNP:201551670
2146+c, tdbSNP:189861783
2210+a, gdbSNP:181501926
2222+c, tdbSNP:142860118
2253+a, gdbSNP:186933088
2314+a, gdbSNP:11569949
2359+c, tdbSNP:191772362
2376+c, tdbSNP:11121880
2580+a, gdbSNP:11569950
2605+a, cdbSNP:75100997
2617+a, gdbSNP:11569951
2668+c, gdbSNP:111829026
2707..2708+, tgggcccagggcctdbSNP:11569952
2751+c, tdbSNP:200537955
2799+c, tdbSNP:183162947
2884+a, gdbSNP:186402138
2897+a, gdbSNP:142324868
2930+c, tdbSNP:189576093
3012+c, tdbSNP:146907046
3021..3022+, cgdbSNP:202212939
3021+c, gdbSNP:520311
3022+c, gdbSNP:201851751
3023+c, gdbSNP:41480747
3024..3025+, gcdbSNP:11569954
3054+a, gdbSNP:182266372
3077+a, cdbSNP:79902471
3148+a, gdbSNP:74053024
3162+c, tdbSNP:368295456
3184+c, tdbSNP:7525045
3197+c, gdbSNP:11569955
3207+a, gdbSNP:187790451
3294+c, tdbSNP:11569956
3296+c, gdbSNP:11569957
3300+a, c, g, tdbSNP:544065
3362+a, gdbSNP:192926082
3489+a, gdbSNP:183161978
3509+a, cdbSNP:201535487
3602+a, cdbSNP:11569958
3611+c, tdbSNP:188581929
Gene SymbolTNFRSF8
Gene SynonymCD30; D1S166E; Ki-1
Chromosome1
Locus Map1p36
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001281430 Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 3, mRNA. On-demand $699.00 18
NM_001243 Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant 1, mRNA. On-demand $849.00 20
XM_006711049 PREDICTED: Homo sapiens tumor necrosis factor receptor superfamily, member 8 (TNFRSF8), transcript variant X1, mRNA. On-demand $699.00 18
Title Protrusion-guided extracellular vesicles mediate CD30 trans-signalling in the microenvironment of Hodgkin's lymphoma .
Author Hansen HP, Engels HM, Dams M, Paes Leme AF, Pauletti BA, Simhadri VL, Durkop H, Reiners KS, Barnert S, Engert A, Schubert R, Quondamatteo F, Hallek M and Pogge von Strandmann E.
Journal J. Pathol. 232 (4), 405-414 (2014)
Title Loss of Foxp3 is associated with CD30 expression in the anaplastic large cell subtype of adult T-cell leukemia/lymphoma (ATLL) in US/Caribbean patients: potential therapeutic implications for CD30 antibody-mediated therapy .
Author Yao J, Gottesman SR, Ayalew G, Braverman AS and Axiotis CA.
Journal Am. J. Surg. Pathol. 37 (9), 1407-1412 (2013)
Title Differential expression of CD30 on CD3 T lymphocytes in patients with systemic lupus erythematosus .
Author Cabrera CM, Urra JM, Carreno A and Zamorano J.
Journal Scand. J. Immunol. 78 (3), 306-312 (2013)
Title Release of soluble CD30 after allogeneic stimulation is mediated by memory T cells and regulated by IFN-gamma and IL-2 .
Author Velasquez SY, Garcia LF, Opelz G, Alvarez CM and Susal C.
Journal Transplantation 96 (2), 154-161 (2013)
Title Soluble CD26 and CD30 levels in patients with common variable immunodeficiency .
Author Mahmoudi M, Hedayat M, Aghamohammadi A and Rezaei N.
Journal J Investig Allergol Clin Immunol 23 (2), 120-124 (2013)
Title Opposite effects of the CD30 ligand are not due to CD30 mutations: results from cDNA cloning and sequence comparison of the CD30 antigen from different sources .
Author Jung W, Krueger S, Renner C, Gause A, Sahin U, Trumper L and Pfreundschuh M.
Journal Mol. Immunol. 31 (17), 1329-1334 (1994)
Title Hyperphosphorylation of a novel 80 kDa protein-tyrosine kinase similar to Ltk in a human Ki-1 lymphoma cell line, AMS3 .
Author Shiota M, Fujimoto J, Semba T, Satoh H, Yamamoto T and Mori S.
Journal Oncogene 9 (6), 1567-1574 (1994)
Title Assignment of the human CD30 (Ki-1) gene to 1p36 .
Author Fonatsch C, Latza U, Durkop H, Rieder H and Stein H.
Journal Genomics 14 (3), 825-826 (1992)
Title Molecular cloning and expression of a new member of the nerve growth factor receptor family that is characteristic for Hodgkin's disease .
Author Durkop H, Latza U, Hummel M, Eitelbach F, Seed B and Stein H.
Journal Cell 68 (3), 421-427 (1992)
Title Ki-1 (CD30) antigen is released by Ki-1-positive tumor cells in vitro and in vivo. I. Partial characterization of soluble Ki-1 antigen and detection of the antigen in cell culture supernatants and in serum by an enzyme-linked immunosorbent assay .
Author Josimovic-Alasevic O, Durkop H, Schwarting R, Backe E, Stein H and Diamantstein T.
Journal Eur. J. Immunol. 19 (1), 157-162 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.