• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin-dependent kinase 3 (CDK3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001258 Homo sapiens cyclin-dependent kinase 3 (CDK3), mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_001258.2, 164519034
Length 1584 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cyclin-dependent kinase 3 (CDK3), mRNA.
Product cyclin-dependent kinase 3
Comment

Summary: This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0. [provided by RefSeq, Jul 2008].


Sequence Note: A downstream translational start codon is selected for this RefSeq based on its better conservation in mammalian species and on a strong Kozak signal. An upstream in-frame start codon is also present but has a weaker Kozak signal and is poorly conserved. Use of the upstream start codon would result in a protein that is 20 aa longer at the N-terminus. Leaky scanning by ribosomes may allow translation initiation at the downstream start codon.

RefSeq NP_001249.1
CDS 77..994
Misc Feature(1)77..955
Misc Feature(2)77..955
Misc Feature(3)83..934
Misc Feature(4)order(104..115,128..130,167..169,173..175,224..226,
Misc Feature(5)order(104..115,128..130,167..169,173..175,266..268,
Misc Feature(6)116..118
Misc Feature(7)119..121
Misc Feature(8)131..133
Misc Feature(9)order(185..187,197..208,212..214,221..226,230..235,
Misc Feature(10)order(224..226,338..340,455..457,461..463,518..520,
Misc Feature(11)506..577
Misc Feature(12)554..556
Misc Feature(13)695..697
Exon (1)1..62
Gene:CDK3
Gene Synonym:CDK3
Exon (2)63..192
Gene:CDK3
Gene Synonym:CDK3
Exon (3)193..270
Gene:CDK3
Gene Synonym:CDK3
Exon (4)271..391
Gene:CDK3
Gene Synonym:CDK3
Exon (5)392..562
Gene:CDK3
Gene Synonym:CDK3
Exon (6)563..664
Gene:CDK3
Gene Synonym:CDK3
Exon (7)665..868
Gene:CDK3
Gene Synonym:CDK3
Exon (8)869..1570
Gene:CDK3
Gene Synonym:CDK3
Translation MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL QRFRH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
106+c, gdbSNP:201970325
139+c, tdbSNP:144487684
166+a, gdbSNP:148459625
190+c, tdbSNP:201517026
207+dbSNP:
207+g, tdbSNP:61742972
225+a, gdbSNP:142601065
265+c, tdbSNP:200587883
266+a, gdbSNP:201723925
268+c, tdbSNP:150589656
289+dbSNP:
289+c, tdbSNP:141186503
293+a, gdbSNP:140567861
295+c, gdbSNP:144506173
440+dbSNP:
440+c, tdbSNP:201685548
447+c, tdbSNP:34918446
457+c, tdbSNP:201794034
488+g, tdbSNP:142329959
514+c, tdbSNP:144754110
536+a, gdbSNP:145748425
539+c, tdbSNP:148982467
549+c, tdbSNP:201655552
583+dbSNP:
583+c, tdbSNP:61747000
671+dbSNP:
671+c, tdbSNP:200505631
708+a, tdbSNP:112568448
717+a, gdbSNP:34670267
718+c, tdbSNP:112384462
753+c, tdbSNP:2069532
760+c, tdbSNP:141477491
761+a, gdbSNP:150330115
844+a, gdbSNP:137860138
852+a, gdbSNP:202135680
867+c, tdbSNP:17884251
871+dbSNP:
871+a, cdbSNP:141494807
896+c, tdbSNP:201330551
921+a, cdbSNP:200812167
928+a, gdbSNP:150329289
974+c, tdbSNP:137958307
1147+a, gdbSNP:17879257
1191+c, tdbSNP:73997685
1219+a, gdbSNP:2069539
1236+a, gdbSNP:191601284
1307+c, tdbSNP:146555944
1546+g, tdbSNP:1135531
Gene SymbolCDK3
Gene SynonymCDK3
Chromosome17
Locus Map17q25.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001258 Homo sapiens cyclin-dependent kinase 3 (CDK3), mRNA. On-demand $449.00 14
Title The retroviral cyclin of walleye dermal sarcoma virus binds cyclin-dependent kinases 3 and 8 .
Author Brewster,C.D., Birkenheuer,C.H., Vogt,M.B., Quackenbush,S.L. and Rovnak,J.
Journal Virology 409 (2), 299-307 (2011)
Title Cyclin-dependent kinase 3-mediated activating transcription factor 1 phosphorylation enhances cell transformation .
Author Zheng,D., Cho,Y.Y., Lau,A.T., Zhang,J., Ma,W.Y., Bode,A.M. and Dong,Z.
Journal Cancer Res. 68 (18), 7650-7660 (2008)
Title Cyclin C/cdk3 promotes Rb-dependent G0 exit .
Author Ren,S. and Rollins,B.J.
Journal Cell 117 (2), 239-251 (2004)
Title Explant-induced reactivation of herpes simplex virus occurs in neurons expressing nuclear cdk2 and cdk4 .
Author Schang,L.M., Bantly,A. and Schaffer,P.A.
Journal J. Virol. 76 (15), 7724-7735 (2002)
Title ik3-2, a relative to ik3-1/cables, is associated with cdk3, cdk5, and c-abl .
Author Sato,H., Nishimoto,I. and Matsuoka,M.
Journal Biochim. Biophys. Acta 1574 (2), 157-163 (2002)
Title Suppression of apoptosis by dominant negative mutants of cyclin-dependent protein kinases .
Author Meikrantz,W. and Schlegel,R.
Journal J. Biol. Chem. 271 (17), 10205-10209 (1996)
Title Phorbol ester inhibits the phosphorylation of the retinoblastoma protein without suppressing cyclin D-associated kinase in vascular smooth muscle cells .
Author Sasaguri,T., Ishida,A., Kosaka,C., Nojima,H. and Ogata,J.
Journal J. Biol. Chem. 271 (14), 8345-8351 (1996)
Title Chromosomal mapping of members of the cdc2 family of protein kinases, cdk3, cdk6, PISSLRE, and PITALRE, and a cdk inhibitor, p27Kip1, to regions involved in human cancer .
Author Bullrich,F., MacLachlan,T.K., Sang,N., Druck,T., Veronese,M.L., Allen,S.L., Chiorazzi,N., Koff,A., Heubner,K., Croce,C.M. et al.
Journal Cancer Res. 55 (6), 1199-1205 (1995)
Title Cdi1, a human G1 and S phase protein phosphatase that associates with Cdk2 .
Author Gyuris,J., Golemis,E., Chertkov,H. and Brent,R.
Journal Cell 75 (4), 791-803 (1993)
Title A family of human cdc2-related protein kinases .
Author Meyerson,M., Enders,G.H., Wu,C.L., Su,L.K., Gorka,C., Nelson,C., Harlow,E. and Tsai,L.H.
Journal EMBO J. 11 (8), 2909-2917 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.