• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cortistatin (CORT), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu08513 Homo sapiens cortistatin (CORT), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu08513C Homo sapiens cortistatin (CORT), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001302.4, 311893368
Length 318 bp
Structure linear
Update Date 27-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens cortistatin (CORT), mRNA.
Product cortistatin preproprotein
Comment

Summary: This gene encodes a neuropeptide that is structurally similar to somatostatin. It binds to all known somatostatin receptors, and shares many pharmacological and functional properties with somatostatin, including the depression of neuronal activity. However, it also has many properties distinct from somatostatin, such as induction of slow-wave sleep, apparently by antagonism of the excitatory effects of acetylcholine on the cortex, reduction of locomotor activity, and activation of cation selective currents not responsive to somatostatin. The preproprotein undergoes further processing into multiple mature products. Read-through transcripts exist between this gene and the upstream APITD1 (apoptosis-inducing, TAF9-like domain 1) gene, as represented in GeneID:100526739. [provided by RefSeq, Nov 2010].

RefSeq NP_001293.3
CDS 506..823
Misc Feature(1)254..256
Misc Feature(2)764..817
Exon (1)1..604
Gene:CORT
Gene Synonym:CST-14; CST-17; CST-29
Exon (2)605..1231
Gene:CORT
Gene Synonym:CST-14; CST-17; CST-29
Translation MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQA SAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
30+dbSNP:
30+c, gdbSNP:139460129
84+c, tdbSNP:181602804
288+g, tdbSNP:185532953
299+a, g, tdbSNP:189899917
312+c, tdbSNP:200789768
313+a, gdbSNP:369706158
320+c, tdbSNP:372771717
342+g, tdbSNP:201903837
405+a, gdbSNP:377214659
436+a, tdbSNP:142020907
475+c, gdbSNP:370073315
520+c, tdbSNP:375806455
521+a, gdbSNP:142755741
545+c, gdbSNP:374605608
546+g, tdbSNP:368245686
559+c, tdbSNP:182159138
569+c, tdbSNP:368651066
601+c, tdbSNP:370903835
618+dbSNP:
618+c, tdbSNP:373837353
691+c, tdbSNP:375132033
692+a, gdbSNP:201158337
698+c, gdbSNP:375844912
705+g, tdbSNP:201163116
715+c, tdbSNP:628462
716+c, tdbSNP:200835553
721+g, tdbSNP:367676737
732+g, tdbSNP:199777356
752+a, cdbSNP:75501939
759+c, tdbSNP:41376048
759+c, tdbSNP:201789443
760+c, tdbSNP:666103
767+c, tdbSNP:145148065
832+c, tdbSNP:146456778
839+g, tdbSNP:375360298
846+a, gdbSNP:192809834
960+c, gdbSNP:184922802
1001+c, tdbSNP:76990442
1045+a, gdbSNP:76343728
1093+a, gdbSNP:377518871
1146+a, gdbSNP:147076752
1207+c, tdbSNP:138494067
1227+a, gdbSNP:386492389
1227+c, tdbSNP:1307497
Gene SymbolCORT
Gene SynonymCST-14; CST-17; CST-29
Chromosome1
Locus Map1p36.22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001302 Homo sapiens cortistatin (CORT), mRNA. On-demand $159.00 7-9
Title Cortistatin inhibits migration and proliferation of human vascular smooth muscle cells and decreases neointimal formation on carotid artery ligation .
Author Duran-Prado M, Morell M, Delgado-Maroto V, Castano JP, Aneiros-Fernandez J, de Lecea L, Culler MD, Hernandez-Cortes P, O'Valle F and Delgado M.
Journal Circ. Res. 112 (11), 1444-1455 (2013)
Title Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients .
Author Saus E, Brunet A, Armengol L, Alonso P, Crespo JM, Fernandez-Aranda F, Guitart M, Martin-Santos R, Menchon JM, Navines R, Soria V, Torrens M, Urretavizcaya M, Valles V, Gratacos M and Estivill X.
Journal J Psychiatr Res 44 (14), 971-978 (2010)
Title Expression of Somatostatin, cortistatin, and their receptors, as well as dopamine receptors, but not of neprilysin, are reduced in the temporal lobe of Alzheimer's disease patients .
Author Gahete MD, Rubio A, Duran-Prado M, Avila J, Luque RM and Castano JP.
Journal J. Alzheimers Dis. 20 (2), 465-475 (2010)
Title The role of cortistatin in the human immune system .
Author van Hagen PM, Dalm VA, Staal F and Hofland LJ.
Journal Mol. Cell. Endocrinol. 286 (1-2), 141-147 (2008)
Title Lowered cortistatin expression is an early event in the human diabetic retina and is associated with apoptosis and glial activation .
Author Carrasco E, Hernandez C, de Torres I, Farres J and Simo R.
Journal Mol. Vis. 14, 1496-1502 (2008)
Title Cortistatin: a member of the somatostatin neuropeptide family with distinct physiological functions .
Author Spier AD and de Lecea L.
Journal Brain Res. Brain Res. Rev. 33 (2-3), 228-241 (2000)
Title Fine mapping of the human preprocortistatin gene (CORT) to neuroblastoma consensus deletion region 1p36.3-->p36.2, but absence of mutations in primary tumors .
Author Ejeskar K, Abel F, Sjoberg R, Backstrom J, Kogner P and Martinsson T.
Journal Cytogenet. Cell Genet. 89 (1-2), 62-66 (2000)
Title Processing of rat preprocortistatin in mouse AtT-20 cells .
Author Puebla L, Mouchantaf R, Sasi R, Khare S, Bennett HP, James S and Patel YC.
Journal J. Neurochem. 73 (3), 1273-1277 (1999)
Title Cloning, mRNA expression, and chromosomal mapping of mouse and human preprocortistatin .
Author de Lecea L, Ruiz-Lozano P, Danielson PE, Peelle-Kirley J, Foye PE, Frankel WN and Sutcliffe JG.
Journal Genomics 42 (3), 499-506 (1997)
Title Identification and characterization of a novel human cortistatin-like peptide .
Author Fukusumi S, Kitada C, Takekawa S, Kizawa H, Sakamoto J, Miyamoto M, Hinuma S, Kitano K and Fujino M.
Journal Biochem. Biophys. Res. Commun. 232 (1), 157-163 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.