• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cortistatin (CORT), mRNA.


RefSeq Accession Definition Services Price Order
NM_001302 Homo sapiens cortistatin (CORT), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001302.4, 311893368
Length 1238 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cortistatin (CORT), mRNA.
Product cortistatin preproprotein
Comment

Summary: This gene encodes a neuropeptide that is structurally similar to somatostatin. It binds to all known somatostatin receptors, and shares many pharmacological and functional properties with somatostatin, including the depression of neuronal activity. However, it also has many properties distinct from somatostatin, such as induction of slow-wave sleep, apparently by antagonism of the excitatory effects of acetylcholine on the cortex, reduction of locomotor activity, and activation of cation selective currents not responsive to somatostatin. The preproprotein undergoes further processing into multiple mature products. Read-through transcripts exist between this gene and the upstream APITD1 (apoptosis-inducing, TAF9-like domain 1) gene, as represented in GeneID:100526739. [provided by RefSeq, Nov 2010].

RefSeq NP_001293.3
CDS 506..823
Misc Feature(1)254..256
Misc Feature(2)764..817
Exon (1)1..604
Gene:CORT
Gene Synonym:CST-14; CST-17; CST-29
Exon (2)605..1231
Gene:CORT
Gene Synonym:CST-14; CST-17; CST-29
Translation MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQA SAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
30+dbSNP:
30+c, gdbSNP:139460129
84+c, tdbSNP:181602804
288+g, tdbSNP:185532953
299+a, g, tdbSNP:189899917
312+c, tdbSNP:200789768
342+g, tdbSNP:201903837
436+a, tdbSNP:142020907
521+a, gdbSNP:142755741
559+c, tdbSNP:182159138
692+dbSNP:
692+a, gdbSNP:201158337
705+g, tdbSNP:201163116
715+c, tdbSNP:628462
716+c, tdbSNP:200835553
732+g, tdbSNP:199777356
752+a, cdbSNP:75501939
759..760+c, tdbSNP:41376048
759+c, tdbSNP:201789443
760+c, tdbSNP:666103
767+c, tdbSNP:145148065
768+a, gdbSNP:149033747
832+c, tdbSNP:146456778
846+a, gdbSNP:192809834
960+c, gdbSNP:184922802
1001+c, tdbSNP:76990442
1045+a, gdbSNP:76343728
1146+a, gdbSNP:147076752
1207+c, tdbSNP:138494067
1227+c, tdbSNP:1307497
Gene SymbolCORT
Gene SynonymCST-14; CST-17; CST-29
Chromosome1
Locus Map1p36.22
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001302 Homo sapiens cortistatin (CORT), mRNA. Full Length $359.02
ORF Sequence $159.00
Title Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients .
Author Saus,E., Brunet,A., Armengol,L., Alonso,P., Crespo,J.M., Fernandez-Aranda,F., Guitart,M., Martin-Santos,R., Menchon,J.M., Navines,R., Soria,V., Torrens,M., Urretavizcaya,M., Valles,V., Gratacos,M. and Estivill,X.
Journal J Psychiatr Res 44 (14), 971-978 (2010)
Title Expression of Somatostatin, cortistatin, and their receptors, as well as dopamine receptors, but not of neprilysin, are reduced in the temporal lobe of Alzheimer's disease patients .
Author Gahete,M.D., Rubio,A., Duran-Prado,M., Avila,J., Luque,R.M. and Castano,J.P.
Journal J. Alzheimers Dis. 20 (2), 465-475 (2010)
Title The role of cortistatin in the human immune system .
Author van Hagen,P.M., Dalm,V.A., Staal,F. and Hofland,L.J.
Journal Mol. Cell. Endocrinol. 286 (1-2), 141-147 (2008)
Title Lowered cortistatin expression is an early event in the human diabetic retina and is associated with apoptosis and glial activation .
Author Carrasco,E., Hernandez,C., de Torres,I., Farres,J. and Simo,R.
Journal Mol. Vis. 14, 1496-1502 (2008)
Title Somatostatin molecular variants in the vitreous fluid: a comparative study between diabetic patients with proliferative diabetic retinopathy and nondiabetic control subjects .
Author Hernandez,C., Carrasco,E., Casamitjana,R., Deulofeu,R., Garcia-Arumi,J. and Simo,R.
Journal Diabetes Care 28 (8), 1941-1947 (2005)
Title Cortistatin: a member of the somatostatin neuropeptide family with distinct physiological functions .
Author Spier,A.D. and de Lecea,L.
Journal Brain Res. Brain Res. Rev. 33 (2-3), 228-241 (2000)
Title Fine mapping of the human preprocortistatin gene (CORT) to neuroblastoma consensus deletion region 1p36.3-->p36.2, but absence of mutations in primary tumors .
Author Ejeskar,K., Abel,F., Sjoberg,R., Backstrom,J., Kogner,P. and Martinsson,T.
Journal Cytogenet. Cell Genet. 89 (1-2), 62-66 (2000)
Title Processing of rat preprocortistatin in mouse AtT-20 cells .
Author Puebla,L., Mouchantaf,R., Sasi,R., Khare,S., Bennett,H.P., James,S. and Patel,Y.C.
Journal J. Neurochem. 73 (3), 1273-1277 (1999)
Title Cloning, mRNA expression, and chromosomal mapping of mouse and human preprocortistatin .
Author de Lecea,L., Ruiz-Lozano,P., Danielson,P.E., Peelle-Kirley,J., Foye,P.E., Frankel,W.N. and Sutcliffe,J.G.
Journal Genomics 42 (3), 499-506 (1997)
Title Identification and characterization of a novel human cortistatin-like peptide .
Author Fukusumi,S., Kitada,C., Takekawa,S., Kizawa,H., Sakamoto,J., Miyamoto,M., Hinuma,S., Kitano,K. and Fujino,M.
Journal Biochem. Biophys. Res. Commun. 232 (1), 157-163 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878