• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens deleted in azoospermia-like (DAZL), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001351 Homo sapiens deleted in azoospermia-like (DAZL), transcript variant 2, mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_001351.3, 299829260
Length 3054 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens deleted in azoospermia-like (DAZL), transcript variant 2, mRNA.
Product deleted in azoospermia-like isoform 2
Comment

Summary: The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010].


Transcript Variant: This variant (2) differs in the 5' UTR and coding sequence compared to variant 1. The resulting isoform (2) has a shorter and distinct N-terminus compared to isoform 2.

RefSeq NP_001342.2
CDS 295..1182
Misc Feature(1)55..57
Misc Feature(2)397..642
Misc Feature(3)397..642
Misc Feature(4)order(406..408,415..417,421..423,502..513,517..519,
Misc Feature(5)order(451..456,463..465,511..513,517..528)
Misc Feature(6)532..690
Exon (1)1..297
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (2)298..444
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (3)445..536
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (4)537..588
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (5)589..652
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (6)653..792
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (7)793..864
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (8)865..915
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (9)916..1029
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (10)1030..1128
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Exon (11)1129..3050
Gene:DAZL
Gene Synonym:DAZH; DAZL1; DAZLA; SPGYLA
Translation MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFF ARYGSVKEVKIITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLC AYHVQPRPLVFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVIT GYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSG NGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(7..8)-dbSNP:
complement(7..8)-, adbSNP:35880485
complement(37)-c, adbSNP:377456415
complement(60)-g, adbSNP:185014146
complement(64)-t, gdbSNP:2241532
complement(72)-t, cdbSNP:374535599
complement(81)-g, adbSNP:370939388
complement(97)-g, cdbSNP:78431097
complement(118)-t, cdbSNP:191406933
complement(207)-g, adbSNP:116172431
209+a, gdbSNP:3177745
complement(236)-g, adbSNP:373749089
complement(249)-g, cdbSNP:374894961
251+c, tdbSNP:11542170
complement(256)-g, adbSNP:200429582
complement(262)-g, cdbSNP:9847342
complement(267)-g, adbSNP:56079331
complement(268)-g, c, adbSNP:201594625
complement(280)-g, adbSNP:113870916
302+dbSNP:
302+c, tdbSNP:1130313
complement(307)-t, gdbSNP:200367943
complement(328)-t, cdbSNP:11710967
complement(335)-g, cdbSNP:61730117
454+dbSNP:
454+a, gdbSNP:121918346
complement(511)-t, cdbSNP:377458477
complement(560)-dbSNP:
complement(560)-t, gdbSNP:75931701
complement(562)-g, cdbSNP:200341557
complement(606)-dbSNP:
complement(606)-g, adbSNP:139840516
complement(652)-g, adbSNP:201242764
complement(689)-dbSNP:
complement(689)-t, cdbSNP:202014772
complement(697)-g, adbSNP:200935066
complement(699)-g, adbSNP:115317726
complement(746)-t, cdbSNP:200210483
complement(747)-g, adbSNP:187552486
complement(750)-t, cdbSNP:374109240
complement(842)-dbSNP:
complement(842)-t, cdbSNP:369007495
complement(871)-dbSNP:
complement(871)-g, adbSNP:371852241
complement(901)-g, adbSNP:192434498
complement(911)-g, adbSNP:199641341
complement(912)-g, adbSNP:200894010
complement(918)-dbSNP:
complement(918)-t, adbSNP:201548497
complement(937)-t, gdbSNP:202023527
complement(943)-t, cdbSNP:373672578
complement(949)-t, cdbSNP:370525637
complement(978)-c, adbSNP:376911882
complement(992)-t, cdbSNP:376220209
complement(995)-t, adbSNP:370868321
complement(1006)-g, adbSNP:188506466
complement(1043)-dbSNP:
complement(1043)-t, cdbSNP:377332785
complement(1093)-t, gdbSNP:191274968
complement(1116)-t, adbSNP:370134721
complement(1142)-dbSNP:
complement(1142)-t, adbSNP:375327855
complement(1184)-g, cdbSNP:200597687
complement(1205)-t, cdbSNP:372263155
1392+c, tdbSNP:1048958
complement(1417)-t, cdbSNP:188447697
complement(1454)-g, adbSNP:367919134
complement(1472)-t, cdbSNP:373453859
complement(1531)-g, cdbSNP:17042443
complement(1546)-t, cdbSNP:144459180
complement(1561)-g, adbSNP:114431761
complement(1563)-t, cdbSNP:183385448
complement(1645)-t, cdbSNP:193027986
complement(1696)-t, cdbSNP:187383615
1739+c, tdbSNP:149243225
complement(1742)-g, adbSNP:77428956
complement(1744)-t, cdbSNP:10510454
complement(1747)-g, adbSNP:139892372
complement(1980)-t, cdbSNP:183118524
complement(2028)-t, adbSNP:2059743
complement(2031)-, adbSNP:34625250
complement(2075)-g, adbSNP:78972593
complement(2158)-t, cdbSNP:184998720
2187+g, tdbSNP:145955761
complement(2209)-t, cdbSNP:182358825
complement(2315..2316)-, gdbSNP:397753811
complement(2317..2318)-, gdbSNP:55679752
complement(2383)-g, adbSNP:73142509
complement(2437)-g, adbSNP:142574083
complement(2562)-t, cdbSNP:371394839
complement(2763)-t, adbSNP:377732428
complement(2810)-t, cdbSNP:137988133
complement(2957)-g, adbSNP:117986067
3007+c, tdbSNP:1048960
complement(3035)-g, cdbSNP:2347312
Gene SymbolDAZL
Gene SynonymDAZH; DAZL1; DAZLA; SPGYLA
Chromosome3
Locus Map3p24.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001190811 Homo sapiens deleted in azoospermia-like (DAZL), transcript variant 1, mRNA. On-demand $449.00 14
NM_001351 Homo sapiens deleted in azoospermia-like (DAZL), transcript variant 2, mRNA. In-stock $348.00 $299.00 10
Title Altered DNA methylation patterns of the H19 differentially methylated region and the DAZL gene promoter are associated with defective human sperm .
Author Li B, Li JB, Xiao XF, Ma YF, Wang J, Liang XX, Zhao HX, Jiang F, Yao YQ and Wang XH.
Journal PLoS ONE 8 (8), E71215 (2013)
Title Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14 .
Author Ruark E, Seal S, McDonald H, Zhang F, Elliot A, Lau K, Perdeaux E, Rapley E, Eeles R, Peto J, Kote-Jarai Z, Muir K, Nsengimana J, Shipley J, Bishop DT, Stratton MR, Easton DF, Huddart RA, Rahman N and Turnbull C.
Journal Nat. Genet. 45 (6), 686-689 (2013)
Title [DAZL gene polymorphisms and astheno-teratozoospermia] .
Author Ye LW, Yu QF, Yang XX, Li JP, Wu XQ, Zhang YH and Mao XM.
Journal Zhonghua Nan Ke Xue 19 (4), 311-314 (2013)
Title Nodal, Nanog, DAZL and SMAD gene expression in human amniotic fluid stem cells .
Author Stefanidis K, Pergialiotis V, Christakis D, Loutradis D and Antsaklis A.
Journal J Stem Cells 8 (1), 17-23 (2013)
Title A single-nucleotide polymorphism of the DAZL gene promoter confers susceptibility to spermatogenic failure in the Taiwanese Han .
Author Teng YN, Chang YP, Tseng JT, Kuo PH, Lee IW, Lee MS and Kuo PL.
Journal Hum. Reprod. 27 (9), 2857-2865 (2012)
Title A putative human male infertility gene DAZLA: genomic structure and methylation status .
Author Chai NN, Phillips A, Fernandez A and Yen PH.
Journal Mol. Hum. Reprod. 3 (8), 705-708 (1997)
Title Gene sequence, localization, and evolutionary conservation of DAZLA, a candidate male sterility gene .
Author Seboun E, Barbaux S, Bourgeron T, Nishi S, Agulnik A, Egashira M, Nikkawa N, Bishop C, Fellous M, McElreavey K and Kasahara M.
Journal Genomics 41 (2), 227-235 (1997)
Title The human autosomal gene DAZLA: testis specificity and a candidate for male infertility .
Author Yen PH, Chai NN and Salido EC.
Journal Hum. Mol. Genet. 5 (12), 2013-2017 (1996)
Title A SPGY copy homologous to the mouse gene Dazla and the Drosophila gene boule is autosomal and expressed only in the human male gonad .
Author Shan Z, Hirschmann P, Seebacher T, Edelmann A, Jauch A, Morell J, Urbitsch P and Vogt PH.
Journal Hum. Mol. Genet. 5 (12), 2005-2011 (1996)
Title The DAZ gene cluster on the human Y chromosome arose from an autosomal gene that was transposed, repeatedly amplified and pruned .
Author Saxena R, Brown LG, Hawkins T, Alagappan RK, Skaletsky H, Reeve MP, Reijo R, Rozen S, Dinulos MB, Disteche CM and Page DC.
Journal Nat. Genet. 14 (3), 292-299 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.