• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens DNA (cytosine-5-)-methyltransferase 1 (DNMT1), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu51480 Homo sapiens DNA (cytosine-5-)-methyltransferase 1 (DNMT1), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $2699.00 30
OHu51480C Homo sapiens DNA (cytosine-5-)-methyltransferase 1 (DNMT1), transcript variant 2, mRNA. Customized vector On-demand $2699.00 30

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001379.2, 195546895
Length 4851 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens DNA (cytosine-5-)-methyltransferase 1 (DNMT1), transcript variant 2, mRNA.
Product DNA (cytosine-5)-methyltransferase 1 isoform b
Comment

Summary: DNA (cytosine-5-)-methyltransferase 1 has a role in the establishment and regulation of tissue-specific patterns of methylated cytosine residues. Aberrant methylation patterns are associated with certain human tumors and developmental abnormalities. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008].


Transcript Variant: This variant (2) lacks an alternate in-frame exon compared to variant 1. The resulting isoform (b) has the same N- and C-termini but is shorter compared to isoform a.

RefSeq NP_001370.1
CDS 181..5031
Misc Feature(1)181..1188
Misc Feature(2)181..1188
Misc Feature(3)181..624
Misc Feature(4)181..540
Misc Feature(5)226..495
Misc Feature(6)388..390
Misc Feature(7)559..561
Misc Feature(8)577..579
Misc Feature(9)604..606
Misc Feature(10)607..609
Misc Feature(11)625..831
Misc Feature(12)634..636
Misc Feature(13)640..642
Misc Feature(14)658..660
Misc Feature(15)667..702
Misc Feature(16)697..699
Misc Feature(17)709..795
Misc Feature(18)742..744
Misc Feature(19)955..957
Misc Feature(20)1102..1998
Misc Feature(21)1108..1686
Misc Feature(22)1171..1830
Misc Feature(23)1276..1278
Misc Feature(24)1360..1362
Misc Feature(25)1375..1782
Misc Feature(26)1705..1707
Misc Feature(27)2113..2253
Misc Feature(28)2131..2271
Misc Feature(29)2257..2442
Misc Feature(30)2320..2322
Misc Feature(31)2320..2322
Misc Feature(32)2320..2322
Misc Feature(33)2374..2376
Misc Feature(34)2425..2427
Misc Feature(35)2440..2811
Misc Feature(36)2851..2853
Misc Feature(37)3040..3042
Misc Feature(38)3049..3051
Misc Feature(39)3061..3063
Misc Feature(40)3073..3483
Misc Feature(41)3085..3087
Misc Feature(42)3103..3105
Misc Feature(43)3340..3342
Misc Feature(44)3505..3540
Misc Feature(45)3511..3513
Misc Feature(46)3517..3519
Misc Feature(47)3523..3525
Misc Feature(48)3529..3531
Misc Feature(49)3541..5028
Misc Feature(50)3592..4956
Misc Feature(51)3595..5028
Misc Feature(52)order(3613..3630,3679..3690,3781..3792,3847..3849,
Misc Feature(53)order(3847..3849,3856..3861,3868..3870,3871..3873,
Misc Feature(54)order(3847..3849,3856..3858,3868..3870,3976..3978,
Misc Feature(55)4225..4227
Misc Feature(56)4423..4425
Exon (1)1..260
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (2)261..297
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (3)298..405
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (4)406..625
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (5)626..701
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (6)702..780
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (7)781..815
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (8)816..900
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (9)901..935
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (10)936..1023
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (11)1024..1058
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (12)1059..1140
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (13)1141..1175
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (14)1176..1221
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (15)1222..1302
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (16)1303..1412
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (17)1413..1531
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (18)1532..1624
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (19)1625..1776
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (20)1777..1964
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (21)1965..2151
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (22)2152..2249
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (23)2250..2397
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (24)2398..2513
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (25)2514..2718
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (26)2719..2852
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (27)2853..3026
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (28)3027..3248
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (29)3249..3441
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (30)3442..3526
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (31)3527..3655
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (32)3656..3938
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (33)3939..4080
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (34)4081..4247
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (35)4248..4425
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (36)4426..4621
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (37)4622..4788
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (38)4789..4905
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (39)4906..4996
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Exon (40)4997..5352
Gene:DNMT1
Gene Synonym:ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Translation MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQ LCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRV GMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKP QEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEK EEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPE EKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYL DDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLC PIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFS TSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGL NLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQAR RQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQ QPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQ GKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVT ALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPS ENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLA EMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPR KEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNK FYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGP NRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLR TLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMA GETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRP RFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAP GEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNG ASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLP NIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCL PHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFP DTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(51)-dbSNP:
complement(51)-t, cdbSNP:185170462
complement(98)-c, adbSNP:369700463
complement(136)-g, adbSNP:375666082
complement(147)-g, adbSNP:112908248
complement(152)-g, adbSNP:375646953
complement(177)-g, cdbSNP:372657357
complement(277)-dbSNP:
complement(277)-t, cdbSNP:374817622
complement(324)-dbSNP:
complement(324)-g, adbSNP:371490768
complement(330)-g, adbSNP:146112081
complement(343)-t, cdbSNP:375585911
complement(386)-t, cdbSNP:61750053
complement(470)-dbSNP:
complement(470)-t, cdbSNP:16999593
complement(470)-g, adbSNP:386541754
complement(481)-g, adbSNP:369196079
complement(507)-g, adbSNP:144685297
complement(508)-t, cdbSNP:376894659
complement(533)-t, cdbSNP:149362098
complement(535)-t, cdbSNP:146516082
complement(537)-t, gdbSNP:373923585
complement(538)-g, cdbSNP:75616428
complement(562)-t, gdbSNP:146601335
complement(566)-g, cdbSNP:370207020
complement(567)-g, adbSNP:369470867
complement(570)-t, cdbSNP:373499917
complement(573)-g, adbSNP:143904813
complement(586)-g, adbSNP:138841970
complement(590)-g, adbSNP:377146699
complement(591)-t, cdbSNP:369311643
complement(612)-g, adbSNP:199715388
620+c, gdbSNP:1140470
complement(652)-dbSNP:
complement(652)-t, gdbSNP:201319352
complement(659)-t, cdbSNP:374440818
complement(707)-dbSNP:
complement(707)-g, adbSNP:62621089
complement(747)-t, cdbSNP:201526918
complement(765)-t, cdbSNP:141264613
complement(819)-dbSNP:
complement(819)-c, adbSNP:61758429
complement(826)-t, gdbSNP:374856119
complement(863)-t, cdbSNP:150999369
complement(866)-g, adbSNP:143598088
complement(868)-g, adbSNP:201749864
complement(872)-t, gdbSNP:370064676
complement(959)-dbSNP:
complement(959)-t, adbSNP:372129479
complement(988)-t, cdbSNP:368960099
complement(1000)-t, cdbSNP:200024502
complement(1022)-t, cdbSNP:201025441
complement(1047)-dbSNP:
complement(1047)-t, cdbSNP:368346471
complement(1051)-t, cdbSNP:148831705
complement(1057)-g, cdbSNP:61758430
complement(1077)-dbSNP:
complement(1077)-g, adbSNP:373861581
complement(1078)-t, cdbSNP:200601847
complement(1109)-t, gdbSNP:143287044
1111+a, c, g, tdbSNP:2228612
complement(1113)-c, adbSNP:61758431
complement(1128)-t, cdbSNP:111225217
complement(1128)-g, adbSNP:16999358
complement(1135)-t, cdbSNP:200531080
complement(1175)-dbSNP:
complement(1175)-g, adbSNP:370592431
complement(1185)-dbSNP:
complement(1185)-t, cdbSNP:139355567
complement(1196)-g, cdbSNP:201945078
complement(1227)-dbSNP:
complement(1227)-g, adbSNP:116502459
complement(1248)-g, adbSNP:147382114
complement(1277)-t, adbSNP:141562679
complement(1299)-g, adbSNP:140747287
complement(1327)-dbSNP:
complement(1327)-t, cdbSNP:142673915
complement(1338)-g, cdbSNP:147235870
complement(1355)-t, cdbSNP:367727676
complement(1356)-g, adbSNP:199584370
complement(1426)-dbSNP:
complement(1426)-g, adbSNP:181300723
complement(1443)-g, adbSNP:200680763
complement(1446)-g, adbSNP:201487376
complement(1452)-g, adbSNP:143925123
1521+a, gdbSNP:2228611
complement(1568)-dbSNP:
complement(1568)-t, gdbSNP:374027926
complement(1590)-g, adbSNP:369649047
complement(1611)-g, adbSNP:376715649
complement(1632)-dbSNP:
complement(1632)-g, adbSNP:75443147
1650..1652+ata, tccdbSNP:199473691
1663+c, tdbSNP:199473692
1664+a, gdbSNP:199473690
complement(1761)-t, cdbSNP:372722081
complement(1764)-g, c, adbSNP:2228613
complement(1780)-dbSNP:
complement(1780)-t, cdbSNP:368761660
complement(1810)-g, adbSNP:375474222
complement(1821)-t, cdbSNP:150385511
1841+c, tdbSNP:397509392
complement(1854)-t, cdbSNP:140376680
complement(1914)-t, cdbSNP:721186
1946+c, gdbSNP:397509393
1948+g, tdbSNP:397509391
complement(1953)-t, cdbSNP:371848582
complement(1993)-dbSNP:
complement(1993)-t, gdbSNP:144567470
complement(2028)-t, cdbSNP:202058239
complement(2064)-g, adbSNP:370444117
complement(2076)-g, adbSNP:61750052
complement(2118)-g, adbSNP:377704053
complement(2119)-t, cdbSNP:146467216
complement(2142)-g, adbSNP:374476495
complement(2284)-dbSNP:
complement(2284)-t, cdbSNP:368319266
complement(2293)-t, cdbSNP:375620967
complement(2400)-dbSNP:
complement(2400)-g, adbSNP:374841430
complement(2418)-g, adbSNP:201088848
complement(2447)-t, gdbSNP:142562681
complement(2463)-g, adbSNP:370056750
complement(2469)-t, gdbSNP:202126672
complement(2475)-g, adbSNP:111961208
complement(2501)-g, adbSNP:113497353
complement(2519)-dbSNP:
complement(2519)-g, adbSNP:148987580
complement(2526)-t, cdbSNP:188377624
complement(2575)-t, cdbSNP:373366822
complement(2577)-g, adbSNP:145803817
complement(2583)-t, cdbSNP:112405538
complement(2595)-g, adbSNP:61750051
complement(2596)-t, cdbSNP:183555527
complement(2603)-g, adbSNP:140993011
complement(2604)-t, cdbSNP:45484792
complement(2607)-t, cdbSNP:368834599
complement(2706)-g, adbSNP:200585003
complement(2733)-dbSNP:
complement(2733)-g, adbSNP:200414033
complement(2754)-g, adbSNP:375136816
complement(2757)-g, adbSNP:200928585
complement(2758)-t, cdbSNP:62621087
complement(2788)-g, cdbSNP:367681882
complement(2799)-g, adbSNP:199832007
complement(2802)-t, cdbSNP:372694243
complement(2808)-g, adbSNP:139861062
complement(2825)-g, adbSNP:201213597
complement(2860)-dbSNP:
complement(2860)-c, adbSNP:150863675
complement(2922)-g, adbSNP:141460564
complement(3046)-dbSNP:
complement(3046)-t, cdbSNP:148038464
complement(3069)-g, adbSNP:150359172
complement(3108)-g, adbSNP:202093243
complement(3168)-g, cdbSNP:376854079
complement(3209)-t, adbSNP:373940840
complement(3229)-g, adbSNP:144533539
complement(3230)-t, cdbSNP:199827346
complement(3288)-dbSNP:
complement(3288)-g, adbSNP:141856197
complement(3289)-t, cdbSNP:370786558
complement(3318)-g, adbSNP:138736029
complement(3328)-t, cdbSNP:187394074
complement(3342)-t, cdbSNP:144874878
complement(3355)-g, adbSNP:140852137
complement(3363)-g, adbSNP:137880469
complement(3387)-g, adbSNP:375882181
complement(3393)-g, adbSNP:374021326
complement(3410)-g, adbSNP:370075258
complement(3425)-c, adbSNP:377078524
complement(3484)-dbSNP:
complement(3484)-g, adbSNP:374676749
complement(3485)-t, cdbSNP:150331990
complement(3490)-g, adbSNP:200950656
complement(3540)-dbSNP:
complement(3540)-g, cdbSNP:144675407
complement(3545)-g, cdbSNP:201308454
complement(3560)-g, adbSNP:375976847
complement(3607..3608)-, cdbSNP:35600922
complement(3624)-g, adbSNP:140951214
complement(3636)-t, cdbSNP:199739823
complement(3651)-t, gdbSNP:151305495
complement(3726)-dbSNP:
complement(3726)-g, adbSNP:375481300
complement(3788)-t, gdbSNP:201497993
complement(3789)-g, adbSNP:142378165
complement(3791)-g, adbSNP:142648642
complement(3801)-g, adbSNP:147755768
complement(3828)-g, adbSNP:145657360
complement(3843)-g, adbSNP:139909192
complement(3891)-t, cdbSNP:201007703
complement(3969)-dbSNP:
complement(3969)-g, adbSNP:200535237
complement(3981)-g, adbSNP:144660201
complement(4045)-g, adbSNP:200312526
complement(4068)-g, adbSNP:367637414
complement(4071)-g, adbSNP:142903301
complement(4092)-dbSNP:
complement(4092)-g, adbSNP:139728982
complement(4095)-g, adbSNP:375300708
complement(4134)-t, cdbSNP:372988540
complement(4164)-t, cdbSNP:150774582
complement(4193)-g, adbSNP:141791913
complement(4240)-t, gdbSNP:201167482
complement(4278)-dbSNP:
complement(4278)-t, cdbSNP:184125970
complement(4290)-g, cdbSNP:368325985
complement(4325)-g, adbSNP:375225009
complement(4353)-g, cdbSNP:367897930
complement(4387)-t, cdbSNP:374047326
complement(4456)-dbSNP:
complement(4456)-g, adbSNP:139918621
4500+c, tdbSNP:2229858
complement(4524)-g, adbSNP:200416276
complement(4560)-c, adbSNP:142647321
complement(4576)-g, adbSNP:147984942
complement(4614)-g, adbSNP:143429853
complement(4626)-dbSNP:
complement(4626)-g, cdbSNP:182154331
complement(4635)-g, adbSNP:149271718
complement(4641)-g, cdbSNP:372868127
complement(4650)-t, cdbSNP:138420591
complement(4731)-g, adbSNP:145860233
complement(4827)-dbSNP:
complement(4827)-g, adbSNP:371699788
complement(4854)-t, gdbSNP:369472235
complement(4948)-dbSNP:
complement(4948)-g, adbSNP:147713850
complement(5008)-dbSNP:
complement(5008)-t, cdbSNP:201774098
complement(5016)-t, adbSNP:370070174
complement(5026)-g, cdbSNP:147118268
complement(5043)-g, adbSNP:375175304
complement(5063)-g, adbSNP:201588324
complement(5102)-t, cdbSNP:375767390
complement(5110)-g, cdbSNP:373395295
complement(5115)-g, adbSNP:75515773
complement(5127)-g, adbSNP:115729223
complement(5178)-t, cdbSNP:386529869
5178+c, tdbSNP:13784
complement(5196)-c, adbSNP:192952800
complement(5221)-g, adbSNP:111234445
complement(5318)-g, adbSNP:189422259
5330+a, tdbSNP:11488
Gene SymbolDNMT1
Gene SynonymADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT
Chromosome19
Locus Map19p13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001379 Homo sapiens DNA (cytosine-5-)-methyltransferase 1 (DNMT1), transcript variant 2, mRNA. On-demand $2699.00 30
NM_001130823 Homo sapiens DNA (cytosine-5-)-methyltransferase 1 (DNMT1), transcript variant 1, mRNA. On-demand $2699.00 30
XM_006722681 PREDICTED: Homo sapiens DNA (cytosine-5-)-methyltransferase 1 (DNMT1), transcript variant X1, mRNA. On-demand $1699.00 25
Title The E2F1/DNMT1 axis is associated with the development of AR negative castration resistant prostate cancer .
Author Valdez CD, Kunju L, Daignault S, Wojno KJ and Day ML.
Journal Prostate 73 (16), 1776-1785 (2013)
Title DNMT1-interacting RNAs block gene-specific DNA methylation .
Author Di Ruscio A, Ebralidze AK, Benoukraf T, Amabile G, Goff LA, Terragni J, Figueroa ME, De Figueiredo Pontes LL, Alberich-Jorda M, Zhang P, Wu M, D'Alo F, Melnick A, Leone G, Ebralidze KK, Pradhan S, Rinn JL and Tenen DG.
Journal Nature 503 (7476), 371-376 (2013)
Title Functional specificity of CpG DNA-binding CXXC domains in mixed lineage leukemia .
Author Risner LE, Kuntimaddi A, Lokken AA, Achille NJ, Birch NW, Schoenfelt K, Bushweller JH and Zeleznik-Le NJ.
Journal J. Biol. Chem. 288 (41), 29901-29910 (2013)
Title DNA-methylation gene network dysregulation in peripheral blood lymphocytes of schizophrenia patients .
Author Auta J, Smith RC, Dong E, Tueting P, Sershen H, Boules S, Lajtha A, Davis J and Guidotti A.
Journal Schizophr. Res. 150 (1), 312-318 (2013)
Title Molecular mechanism of SLC5A8 inactivation in breast cancer .
Author Elangovan S, Pathania R, Ramachandran S, Ananth S, Padia RN, Srinivas SR, Babu E, Hawthorn L, Schoenlein PV, Boettger T, Smith SB, Prasad PD, Ganapathy V and Thangaraju M.
Journal Mol. Cell. Biol. 33 (19), 3920-3935 (2013)
Title New 5' regions of the murine and human genes for DNA (cytosine-5)-methyltransferase .
Author Yoder JA, Yen RW, Vertino PM, Bestor TH and Baylin SB.
Journal J. Biol. Chem. 271 (49), 31092-31097 (1996)
Title E2F-5, a new E2F family member that interacts with p130 in vivo .
Author Hijmans EM, Voorhoeve PM, Beijersbergen RL, van 't Veer LJ and Bernards R.
Journal Mol. Cell. Biol. 15 (6), 3082-3089 (1995)
Title DNMT1-Related Dementia, Deafness, and Sensory Neuropathy .
Author Klein,C.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Isolation and characterization of the cDNA encoding human DNA methyltransferase .
Author Yen RW, Vertino PM, Nelkin BD, Yu JJ, el-Deiry W, Cumaraswamy A, Lennon GG, Trask BJ, Celano P and Baylin SB.
Journal Nucleic Acids Res. 20 (9), 2287-2291 (1992)
Title Cloning and sequencing of a cDNA encoding DNA methyltransferase of mouse cells. The carboxyl-terminal domain of the mammalian enzymes is related to bacterial restriction methyltransferases .
Author Bestor T, Laudano A, Mattaliano R and Ingram V.
Journal J. Mol. Biol. 203 (4), 971-983 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.