• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001410 Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $4749.00 40

*Business Day

Related Services

RefSeq Version NM_001410.2, 145701024
Length 10966 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 2, mRNA.
Product multiple epidermal growth factor-like domains protein 8 isoform 2 precursor
Comment

Summary: The protein encoded by this gene is a single-pass type I membrane protein of unknown function that contains several EGF-like domains, Kelch repeats, and PSI domains. Defects in this gene are a cause of Carpenter syndrome 2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012].


Transcript Variant: This variant (2) lacks an alternate in-frame exon compared to variant 1. The resulting isoform (2) has the same N- and C-termini but is shorter compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.


##Evidence-Data-START## Transcript exon combination :: BC153880.1, AB011541.2 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001401.2
CDS 636..8972
Misc Feature(1)612..614
Misc Feature(2)780..1052
Misc Feature(3)order(846..848,861..863,963..965,1035..1037,1041..1043,
Misc Feature(4)1353..1493
Misc Feature(5)3654..3761
Misc Feature(6)order(3654..3656,3663..3665,3711..3713)
Misc Feature(7)4062..4211
Misc Feature(8)4065..4211
Misc Feature(9)order(4065..4067,4071..4073,4104..4106,4125..4127,
Misc Feature(10)5127..5258
Misc Feature(11)5322..5474
Misc Feature(12)5784..5903
Misc Feature(13)6972..>7064
Exon (1)1..822
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (2)823..986
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (3)987..1193
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (4)1194..1374
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (5)1375..1463
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (6)1464..1879
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (7)1880..2025
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (8)2026..2148
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (9)2149..2303
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (10)2304..2423
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (11)2424..2568
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (12)2569..2732
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (13)2733..2933
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (14)2934..3170
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (15)3171..3289
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (16)3290..3421
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (17)3422..3535
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (18)3536..3784
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (19)3785..3984
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (20)3985..4195
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (21)4196..4445
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (22)4446..4578
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (23)4579..4826
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (24)4827..4937
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (25)4938..5056
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (26)5057..5264
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (27)5265..5445
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (28)5446..5609
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (29)5610..5777
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (30)5778..5922
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (31)5923..6154
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (32)6155..6278
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (33)6279..6492
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (34)6493..6707
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (35)6708..6915
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (36)6916..7075
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (37)7076..7268
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (38)7269..7439
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (39)7440..7570
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (40)7571..7703
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (41)7704..10966
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Translation MALGKVLAMALVLALAVLGSLSPGARAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL IEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLL HLFSDANYNLLGFNASFRFSLCPGGCQSHGQCQPPGVCACEPGWGGPDCGLQECSAYCGS HGTCASPLGPCRCEPGFLGRACDLHLWENQGAGWWHNVSARDPAFSARIGAAGAFLSPPG LLAVFGGQDLNNALGDLVLYNFSANTWESWDLSPAPAARHSHVAVAWAGSLVLMGGELAD GSLTNDVWAFSPLGRGHWELLAPPASSSSGPPGLAGHAAALVDDVWLYVSGGRTPHDLFS SGLFRFRLDSTSGGYWEQVIPAGGRPPAATGHSMVFHAPSRALLVHGGHRPSTARFSVRV NSTELFHVDRHVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDG IFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDL MAYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTPLGACPAA SCLGLGRLLGDCQACLAFSSPTAPPRGPGTLGWCVHNESCLPRPEQARCRGEQISGTVGW WGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNTSQPDKEEVGRWVAHQEKETRRLQRPG SARLFPLPGRDHKYAVEIQGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFLEPYRSSS CTSYSSCLGCLADQGCGWCLTSATCHLRQGGAHCGDDGAGGSLLVLVPTLCPLCEEHRDC HACTQDPFCEWHQSTSRKGDAACSRRGRGRGALKSPEECPPLCSQRLTCEDCLANSSQCA WCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCDGFLTCHECLQSHECGWCGNE DNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLPVALPARWAYARCPDVDECRLGLARCHP RATCLNTPLSYECHCQRGYQGDGISHCNRTCLEDCGHGVCSGPPDFTCVCDLGWTSDLPP PTPAPGPPAPRCSRDCGCSFHSHCRKRGPGFCDECQDWTWGEHCERCRPGSFGNATGSRG CRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSCFRECGGRA LLTNVSSVALGSRRVGGLLPPGGGAARAGPGLSYCVWVVSATEELQPCAPGTLCPPLTLT FSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQALSGLLVLH WEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWAGPHCRMA LCPENCNAHTGAGTCNQSLGVCICAEGFGGPDCATKLDGGQLVWETLMDSRLSADTASRF LHRLGHTMVDGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGGPGPSPRS FHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQWRQEKAPQTVELPAVAGHTLTA RRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYHEATDSLY VFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKRDRMRNVRGSSRGLGQVPGEQP GSWGFREVRKKMALWAALAGTGGFLEEISPHLKEPRPRLFHASALLGDTMVVLGGRSDPD EFSSDVLLYQVNCNAWLLPDLTRSASVGPPMEESVAHAVAAVGSRLYISGGFGGVALGRL LALTLPPDPCRLLSSPEACNQSGACTWCHGACLSGDQAHRLGCGGSPCSPMPRSPEECRR LRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFW AGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVSPM PVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSSSLQQCLSPSYLPLRCMAGGC GRLLRGPESCSLGCAQATQCALCLRRPHCGWCAWGGQDGGGRCMEGGLSGPRDGLTCGRP GASWAFLSCPPEDECANGHHDCNETQNCHDQPHGYECSCKTGYTMDNMTGLCRPVCAQGC VNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCLLCRNHTKGSHCEQCLP LFVGSAVGGGTCRPCHAFCRGNSHICISRKELQMSKGEPKKYSLDPEEIENWVTEGPSED EAVCVNCQNNSYGEKCESCLQGYFLLDGKCTKCQCNGHADTCNEQDGTGCPCQNNTETGT CQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPTSQTNCFHEPKR RALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAPDTGVHTVHIQ PPPAPPPPPPPADGGPRGAGDPGGAGASSGPGAPAEPRVREVWPRGLITYVTVTEPSAVL VVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGLLFFRQDQAHID LFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRPFAKVTVCFPPD PTAPASAWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPMGGGCCPPAIPATTAGLRAGP ITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGGGGGAGGSGHGT GAGRKGLLSQDNLTSMSL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
65+dbSNP:
65+a, gdbSNP:71361013
358+a, gdbSNP:77483366
477+a, tdbSNP:111536758
486..487+, gdbSNP:34768812
509+c, tdbSNP:184902062
599+a, cdbSNP:201236933
913+dbSNP:
913+c, gdbSNP:200910137
958+c, tdbSNP:201353508
963+a, cdbSNP:183986572
972+a, gdbSNP:188320625
982+a, gdbSNP:200462288
992+dbSNP:
992+a, gdbSNP:115536529
1037+c, tdbSNP:117439608
1130+c, gdbSNP:146885610
1132+g, tdbSNP:79719576
1133+c, tdbSNP:78558888
1135+c, gdbSNP:62114375
1192+c, tdbSNP:111865089
1200+dbSNP:
1200+a, gdbSNP:200037040
1233+c, tdbSNP:200803481
1234+a, gdbSNP:201881006
1335+a, gdbSNP:201282412
1554+dbSNP:
1554+a, gdbSNP:201180083
1653+a, gdbSNP:200235162
1666+a, gdbSNP:199720072
1699+c, tdbSNP:201929902
1797+a, gdbSNP:200502457
1832+c, tdbSNP:149190709
1842+c, tdbSNP:201062210
1917+dbSNP:
1917+a, gdbSNP:200630623
1939+c, tdbSNP:200021307
1940+a, gdbSNP:202046167
2018+a, gdbSNP:146980004
2045+dbSNP:
2045+c, tdbSNP:138141882
2081+a, cdbSNP:141773838
2150+dbSNP:
2150+c, tdbSNP:201031505
2183+c, tdbSNP:200112539
2204+c, tdbSNP:150171260
2253+a, tdbSNP:138359626
2342+dbSNP:
2342+c, tdbSNP:201780276
2495+dbSNP:
2495+c, tdbSNP:149246261
2537+c, tdbSNP:150535071
2571+dbSNP:
2571+a, cdbSNP:201134458
2621+a, gdbSNP:200647067
2649+a, gdbSNP:139182618
2674+a, tdbSNP:199665461
2708+a, gdbSNP:199656818
2713+a, gdbSNP:142485616
2716+c, tdbSNP:201674841
2776+dbSNP:
2776+a, gdbSNP:146355445
2791+c, gdbSNP:114954140
2852+g, tdbSNP:184412435
2864+c, tdbSNP:28621009
2870+a, gdbSNP:199938628
2884+a, gdbSNP:151116615
2888+c, tdbSNP:140035679
2933+c, tdbSNP:201202292
2971+dbSNP:
2971+c, tdbSNP:148207079
2987+c, tdbSNP:201242310
3058+a, gdbSNP:149768800
3069+g, tdbSNP:147886477
3077+c, tdbSNP:141629313
3078+a, gdbSNP:147068787
3086+c, tdbSNP:200383522
3137+c, tdbSNP:201814836
3217+dbSNP:
3217+c, tdbSNP:200104182
3279+c, tdbSNP:147606609
3324+dbSNP:
3324+a, gdbSNP:149088443
3333+a, gdbSNP:143160271
3364+c, tdbSNP:148272553
3414+a, gdbSNP:200485103
3444+dbSNP:
3444+c, tdbSNP:141383715
3467+c, tdbSNP:145216125
3491+c, tdbSNP:147534464
3588+dbSNP:
3588+c, tdbSNP:202039332
3856+dbSNP:
3856+a, gdbSNP:200096403
3860+a, gdbSNP:137894484
3867+c, tdbSNP:115335139
3884+c, tdbSNP:149155949
3890+a, gdbSNP:200838638
3975+a, gdbSNP:185009718
4023+dbSNP:
4023+a, gdbSNP:139332716
4077+a, gdbSNP:149613080
4078+c, tdbSNP:1212934
4082+c, tdbSNP:144358189
4194+c, tdbSNP:200195292
4277+dbSNP:
4277+a, gdbSNP:148792547
4280+c, tdbSNP:142473307
4319+c, tdbSNP:147869980
4385+c, tdbSNP:139891048
4386+g, tdbSNP:145408127
4389+a, gdbSNP:147694432
4402+c, gdbSNP:189681080
4424+c, tdbSNP:141015952
4445+a, gdbSNP:149716961
4454+dbSNP:
4454+c, tdbSNP:35473255
4475+c, tdbSNP:148895205
4482+c, tdbSNP:201209045
4497+a, gdbSNP:3745234
4499+c, tdbSNP:61995685
4586+dbSNP:
4586+c, tdbSNP:34225188
4630+a, gdbSNP:140800806
4637+a, gdbSNP:183527379
4649+c, tdbSNP:150132353
4670+c, tdbSNP:144628745
4682+c, tdbSNP:112934297
4693+a, cdbSNP:148217267
4698+a, gdbSNP:141221243
4732+a, gdbSNP:150661961
4768+g, tdbSNP:138904325
4785+a, gdbSNP:143284029
4849+dbSNP:
4849+c, tdbSNP:147539384
4850+c, tdbSNP:139822806
4859+c, tdbSNP:145348824
4874+c, tdbSNP:138473998
4937+c, tdbSNP:148739946
4950+dbSNP:
4950+c, tdbSNP:142361779
4982+a, gdbSNP:151186249
5003+a, gdbSNP:201294981
5025+c, tdbSNP:200791026
5063+dbSNP:
5063+a, gdbSNP:140305632
5072..5073+, gdbSNP:35399265
5087+c, gdbSNP:201947104
5116+c, tdbSNP:144124759
5147+c, tdbSNP:149279834
5159+c, tdbSNP:200468005
5177+c, gdbSNP:77422116
5215+a, gdbSNP:141153248
5220+c, tdbSNP:144595008
5269+dbSNP:
5269+a, cdbSNP:138397020
5276+c, tdbSNP:35468447
5291+c, tdbSNP:143507034
5324+c, gdbSNP:148341236
5356+c, tdbSNP:200200636
5452+dbSNP:
5452+a, gdbSNP:143215498
5543+c, tdbSNP:185198604
5552+c, tdbSNP:190043758
5631+dbSNP:
5631+c, tdbSNP:113983707
5673+c, tdbSNP:147522761
5691+c, tdbSNP:139859934
5692+a, gdbSNP:201626121
5706+c, tdbSNP:1206038
5715+c, gdbSNP:150607375
5750+a, gdbSNP:112433681
5754+c, gdbSNP:149787596
5782+dbSNP:
5782+a, gdbSNP:183945597
5814+g, tdbSNP:144734416
5846+a, gdbSNP:139648725
5870+c, tdbSNP:144090986
5909+a, gdbSNP:116630802
5926+dbSNP:
5926+c, tdbSNP:139959427
5946+a, gdbSNP:200501111
5958+c, gdbSNP:143508185
5993+a, gdbSNP:36016565
6011..6012+, gdbSNP:34886828
6011+c, tdbSNP:151134622
6068+c, tdbSNP:62648096
6120+c, tdbSNP:150311870
6156+dbSNP:
6156+c, tdbSNP:144945446
6167+a, gdbSNP:138644598
6174+c, gdbSNP:147084460
6185+a, gdbSNP:200526872
6291+dbSNP:
6291+c, tdbSNP:34475546
6339+a, gdbSNP:138497881
6343+g, tdbSNP:200684391
6368+c, tdbSNP:200085640
6371+a, gdbSNP:200310970
6393+c, tdbSNP:144057511
6419+a, gdbSNP:143397959
6572+dbSNP:
6572+c, tdbSNP:148286629
6578+a, gdbSNP:141413149
6596+a, gdbSNP:200338219
6645+a, cdbSNP:202175287
6656+a, gdbSNP:150834651
6769+dbSNP:
6769+a, gdbSNP:139601509
6787+c, tdbSNP:142880692
6829+a, gdbSNP:201140958
6909+c, tdbSNP:201858033
6935+dbSNP:
6935+a, gdbSNP:145990797
6953+a, gdbSNP:2288922
7010+a, gdbSNP:10425783
7103+dbSNP:
7103+c, tdbSNP:199937913
7139+c, tdbSNP:149735243
7199+c, tdbSNP:145630132
7234+a, gdbSNP:201847832
7255+a, gdbSNP:73554568
7265+a, cdbSNP:148494208
7322+dbSNP:
7322+c, tdbSNP:35019445
7344+a, gdbSNP:185811990
7354+c, gdbSNP:142506261
7365+c, tdbSNP:150940603
7368+a, gdbSNP:142042363
7475+dbSNP:
7475+c, tdbSNP:145886667
7476+a, gdbSNP:147708727
7482+a, gdbSNP:73033442
7487+c, tdbSNP:28483598
7488+a, gdbSNP:112167630
7496+c, tdbSNP:149439392
7510+a, gdbSNP:143643113
7523+c, tdbSNP:138235390
7648+dbSNP:
7648+c, tdbSNP:142829766
7706+dbSNP:
7706+c, tdbSNP:113822011
7707+a, gdbSNP:146094970
7841+a, gdbSNP:111595088
7855+a, gdbSNP:45623135
7864..7865+, tdbSNP:36086620
7910+a, gdbSNP:199786210
7968+a, gdbSNP:150782421
8001+a, gdbSNP:139192223
8037+c, gdbSNP:149965041
8094+g, tdbSNP:112469278
8107+c, tdbSNP:147216997
8139+a, gdbSNP:147133204
8147+a, gdbSNP:200748447
8165+c, tdbSNP:3745237
8171+a, gdbSNP:78335246
8177+a, gdbSNP:144256916
8196+a, gdbSNP:147796963
8208+a, gdbSNP:148860986
8220+a, cdbSNP:140517402
8289+a, gdbSNP:151306881
8296+a, gdbSNP:140588377
8310+a, gdbSNP:200506642
8327+c, tdbSNP:150486662
8476+a, gdbSNP:199675024
8519+, cdbSNP:35869141
8573+c, tdbSNP:199681302
8603+c, tdbSNP:138179740
8610+c, tdbSNP:141224456
8771+c, tdbSNP:115428796
8860+a, gdbSNP:11881304
8883..8884+, gdbSNP:36092031
8950+a, cdbSNP:61978610
8996+a, gdbSNP:183763590
9000+c, tdbSNP:201280861
9029+c, tdbSNP:186608346
9083+, cdbSNP:34892701
9145+c, tdbSNP:76737545
9178+a, gdbSNP:113687701
9184+c, tdbSNP:75698590
9226+a, cdbSNP:140158124
9250+a, gdbSNP:117510235
9276+c, tdbSNP:7248473
9424+a, gdbSNP:191467722
9545+a, gdbSNP:149900703
9858..9859+, tdbSNP:34366582
9877+a, gdbSNP:113078604
9950+c, tdbSNP:182796455
9984..9985+, adbSNP:71812678
10037+c, tdbSNP:140796510
10038+a, gdbSNP:186938488
10129+a, gdbSNP:191355802
10137+a, gdbSNP:145916665
10140+a, gdbSNP:77151871
10281+a, tdbSNP:138454226
10418+c, tdbSNP:28572784
10426+g, tdbSNP:74859271
10472+a, gdbSNP:183496152
10528+c, tdbSNP:112456113
10594+a, gdbSNP:45444992
10621+c, tdbSNP:11878207
10625+c, tdbSNP:187974955
10629+g, tdbSNP:117935336
10673+c, tdbSNP:1053626
10711+a, gdbSNP:2304211
10756+c, tdbSNP:1053629
10772+c, tdbSNP:1053630
10824+c, gdbSNP:11878297
10875+, tdbSNP:3214618
10894+a, gdbSNP:1053632
10898+a, gdbSNP:2304210
10911+a, gdbSNP:143324344
Gene SymbolMEGF8
Gene SynonymC19orf49; CRPT2; EGFL4; SBP1
Chromosome19
Locus Map19q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001271938 Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 1, mRNA. On-demand $4749.00 40
NM_001410 Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 2, mRNA. On-demand $4749.00 40
Title Mutations in multidomain protein MEGF8 identify a Carpenter syndrome subtype associated with defective lateralization .
Author Twigg,S.R., Lloyd,D., Jenkins,D., Elcioglu,N.E., Cooper,C.D., Al-Sannaa,N., Annagur,A., Gillessen-Kaesbach,G., Huning,I., Knight,S.J., Goodship,J.A., Keavney,B.D., Beales,P.L., Gileadi,O., McGowan,S.J. and Wilkie,A.O.
Journal Am. J. Hum. Genet. 91 (5), 897-905 (2012)
Title Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening .
Author Nakayama,M., Nakajima,D., Nagase,T., Nomura,N., Seki,N. and Ohara,O.
Journal Genomics 51 (1), 27-34 (1998)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.