• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001410 Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $4749.00 40

*Business Day

Related Services

RefSeq Version NM_001410.2, 145701024
Length 10966 bp
Structure linear
Update Date 30-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 2, mRNA.
Product multiple epidermal growth factor-like domains protein 8 isoform 2 precursor
Comment

Summary: The protein encoded by this gene is a single-pass type I membrane protein of unknown function that contains several EGF-like domains, Kelch repeats, and PSI domains. Defects in this gene are a cause of Carpenter syndrome 2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012].


Transcript Variant: This variant (2) lacks an alternate in-frame exon compared to variant 1. The resulting isoform (2) has the same N- and C-termini but is shorter compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.


##Evidence-Data-START## Transcript exon combination :: BC153880.1, AB011541.2 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_001401.2
CDS 636..8972
Misc Feature(1)612..614
Misc Feature(2)780..1052
Misc Feature(3)order(846..848,861..863,963..965,1035..1037,1041..1043,
Misc Feature(4)1353..1493
Misc Feature(5)3654..3761
Misc Feature(6)order(3654..3656,3663..3665,3711..3713)
Misc Feature(7)4062..4211
Misc Feature(8)order(4065..4067,4071..4073,4104..4106,4125..4127,
Misc Feature(9)5127..5258
Misc Feature(10)5322..5474
Misc Feature(11)5784..5903
Exon (1)1..822
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (2)823..986
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (3)987..1193
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (4)1194..1374
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (5)1375..1463
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (6)1464..1879
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (7)1880..2025
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (8)2026..2148
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (9)2149..2303
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (10)2304..2423
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (11)2424..2568
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (12)2569..2732
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (13)2733..2933
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (14)2934..3170
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (15)3171..3289
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (16)3290..3421
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (17)3422..3535
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (18)3536..3784
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (19)3785..3984
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (20)3985..4195
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (21)4196..4445
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (22)4446..4578
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (23)4579..4826
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (24)4827..4937
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (25)4938..5056
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (26)5057..5264
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (27)5265..5445
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (28)5446..5609
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (29)5610..5777
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (30)5778..5922
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (31)5923..6154
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (32)6155..6278
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (33)6279..6492
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (34)6493..6707
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (35)6708..6915
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (36)6916..7075
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (37)7076..7268
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (38)7269..7439
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (39)7440..7570
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (40)7571..7703
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Exon (41)7704..10966
Gene:MEGF8
Gene Synonym:C19orf49; CRPT2; EGFL4; SBP1
Translation MALGKVLAMALVLALAVLGSLSPGARAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL IEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLL HLFSDANYNLLGFNASFRFSLCPGGCQSHGQCQPPGVCACEPGWGGPDCGLQECSAYCGS HGTCASPLGPCRCEPGFLGRACDLHLWENQGAGWWHNVSARDPAFSARIGAAGAFLSPPG LLAVFGGQDLNNALGDLVLYNFSANTWESWDLSPAPAARHSHVAVAWAGSLVLMGGELAD GSLTNDVWAFSPLGRGHWELLAPPASSSSGPPGLAGHAAALVDDVWLYVSGGRTPHDLFS SGLFRFRLDSTSGGYWEQVIPAGGRPPAATGHSMVFHAPSRALLVHGGHRPSTARFSVRV NSTELFHVDRHVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDG IFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDL MAYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTPLGACPAA SCLGLGRLLGDCQACLAFSSPTAPPRGPGTLGWCVHNESCLPRPEQARCRGEQISGTVGW WGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNTSQPDKEEVGRWVAHQEKETRRLQRPG SARLFPLPGRDHKYAVEIQGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFLEPYRSSS CTSYSSCLGCLADQGCGWCLTSATCHLRQGGAHCGDDGAGGSLLVLVPTLCPLCEEHRDC HACTQDPFCEWHQSTSRKGDAACSRRGRGRGALKSPEECPPLCSQRLTCEDCLANSSQCA WCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCDGFLTCHECLQSHECGWCGNE DNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLPVALPARWAYARCPDVDECRLGLARCHP RATCLNTPLSYECHCQRGYQGDGISHCNRTCLEDCGHGVCSGPPDFTCVCDLGWTSDLPP PTPAPGPPAPRCSRDCGCSFHSHCRKRGPGFCDECQDWTWGEHCERCRPGSFGNATGSRG CRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSCFRECGGRA LLTNVSSVALGSRRVGGLLPPGGGAARAGPGLSYCVWVVSATEELQPCAPGTLCPPLTLT FSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQALSGLLVLH WEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWAGPHCRMA LCPENCNAHTGAGTCNQSLGVCICAEGFGGPDCATKLDGGQLVWETLMDSRLSADTASRF LHRLGHTMVDGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGGPGPSPRS FHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQWRQEKAPQTVELPAVAGHTLTA RRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYHEATDSLY VFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKRDRMRNVRGSSRGLGQVPGEQP GSWGFREVRKKMALWAALAGTGGFLEEISPHLKEPRPRLFHASALLGDTMVVLGGRSDPD EFSSDVLLYQVNCNAWLLPDLTRSASVGPPMEESVAHAVAAVGSRLYISGGFGGVALGRL LALTLPPDPCRLLSSPEACNQSGACTWCHGACLSGDQAHRLGCGGSPCSPMPRSPEECRR LRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFW AGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVSPM PVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSSSLQQCLSPSYLPLRCMAGGC GRLLRGPESCSLGCAQATQCALCLRRPHCGWCAWGGQDGGGRCMEGGLSGPRDGLTCGRP GASWAFLSCPPEDECANGHHDCNETQNCHDQPHGYECSCKTGYTMDNMTGLCRPVCAQGC VNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCLLCRNHTKGSHCEQCLP LFVGSAVGGGTCRPCHAFCRGNSHICISRKELQMSKGEPKKYSLDPEEIENWVTEGPSED EAVCVNCQNNSYGEKCESCLQGYFLLDGKCTKCQCNGHADTCNEQDGTGCPCQNNTETGT CQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPTSQTNCFHEPKR RALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAPDTGVHTVHIQ PPPAPPPPPPPADGGPRGAGDPGGAGASSGPGAPAEPRVREVWPRGLITYVTVTEPSAVL VVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGLLFFRQDQAHID LFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRPFAKVTVCFPPD PTAPASAWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPMGGGCCPPAIPATTAGLRAGP ITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGGGGGAGGSGHGT GAGRKGLLSQDNLTSMSL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
65+dbSNP:
65+a, gdbSNP:71361013
193+g, tdbSNP:373999413
273+a, gdbSNP:377656252
358+a, gdbSNP:77483366
477+a, tdbSNP:111536758
486..487+, gdbSNP:34768812
504+c, gdbSNP:370533137
509+c, tdbSNP:184902062
599+a, cdbSNP:201236933
642+c, tdbSNP:371769004
712+g, tdbSNP:377001753
869+dbSNP:
869+c, tdbSNP:377231910
881+g, tdbSNP:369259465
896+c, tdbSNP:370064427
897+a, gdbSNP:372955721
905+c, tdbSNP:376175890
906+a, gdbSNP:369362097
913+c, gdbSNP:200910137
918+c, tdbSNP:376057779
921+g, tdbSNP:370744518
926+a, gdbSNP:374407078
958+c, tdbSNP:201353508
963+a, cdbSNP:183986572
968+c, tdbSNP:371108976
972+a, gdbSNP:188320625
982+a, gdbSNP:200462288
992+dbSNP:
992+a, gdbSNP:115536529
1025+a, gdbSNP:377093238
1037+c, tdbSNP:117439608
1056+c, tdbSNP:372360094
1088+a, gdbSNP:375747976
1130+c, gdbSNP:146885610
1132+g, tdbSNP:79719576
1133+c, tdbSNP:78558888
1135+c, gdbSNP:62114375
1192+c, tdbSNP:111865089
1200+dbSNP:
1200+a, gdbSNP:200037040
1233+c, tdbSNP:200803481
1234+a, gdbSNP:201881006
1273+c, gdbSNP:374831922
1313+c, tdbSNP:373385185
1335+a, gdbSNP:201282412
1365+c, gdbSNP:370196231
1370+c, tdbSNP:374994765
1371+a, gdbSNP:367866745
1407+dbSNP:
1407+a, gdbSNP:375853163
1424+c, tdbSNP:368954010
1425+a, gdbSNP:371198327
1433+c, tdbSNP:374751788
1488+dbSNP:
1488+a, gdbSNP:376248434
1536+a, gdbSNP:369528104
1553+c, tdbSNP:373759775
1554+a, gdbSNP:201180083
1622+a, gdbSNP:371526577
1646+c, tdbSNP:370064096
1653+a, gdbSNP:200235162
1659+a, gdbSNP:372990477
1666+a, gdbSNP:199720072
1699+c, tdbSNP:201929902
1797+a, gdbSNP:200502457
1832+c, tdbSNP:149190709
1842+c, tdbSNP:201062210
1864+a, gdbSNP:370518508
1910+dbSNP:
1910+c, tdbSNP:370779185
1917+a, gdbSNP:200630623
1924+a, gdbSNP:375504309
1939+c, tdbSNP:200021307
1940+a, gdbSNP:202046167
1946+a, gdbSNP:372297256
1977+c, tdbSNP:397514621
2018+a, gdbSNP:146980004
2045+dbSNP:
2045+c, tdbSNP:138141882
2057+a, gdbSNP:373127505
2077+c, tdbSNP:370287880
2081+a, cdbSNP:141773838
2132+a, gdbSNP:374205876
2150+dbSNP:
2150+c, tdbSNP:201031505
2183+c, tdbSNP:200112539
2204+c, tdbSNP:150171260
2207+c, tdbSNP:375943387
2253+a, tdbSNP:138359626
2303+c, tdbSNP:370015031
2333+dbSNP:
2333+a, cdbSNP:377340282
2337+c, tdbSNP:369202655
2342+c, tdbSNP:201780276
2352+c, tdbSNP:369696855
2359+c, tdbSNP:373575110
2399+c, tdbSNP:267605514
2401+a, cdbSNP:377009181
2444+dbSNP:
2444+a, gdbSNP:369970545
2468+c, gdbSNP:372468505
2495+c, tdbSNP:149246261
2511+c, tdbSNP:369796236
2525+c, gdbSNP:377040375
2537+c, tdbSNP:150535071
2545+a, gdbSNP:369191682
2571+dbSNP:
2571+a, cdbSNP:201134458
2621+a, gdbSNP:200647067
2641+c, tdbSNP:370121559
2649+a, gdbSNP:139182618
2658+a, gdbSNP:374100226
2674+a, tdbSNP:199665461
2708+a, gdbSNP:199656818
2713+a, gdbSNP:142485616
2716+c, tdbSNP:201674841
2776+dbSNP:
2776+a, gdbSNP:146355445
2791+c, gdbSNP:114954140
2824+a, gdbSNP:368683081
2852+g, tdbSNP:184412435
2864+c, tdbSNP:28621009
2869+c, tdbSNP:372613242
2870+a, gdbSNP:199938628
2884+a, gdbSNP:151116615
2888+c, tdbSNP:140035679
2933+c, tdbSNP:201202292
2966+dbSNP:
2966+c, tdbSNP:376907694
2969+a, gdbSNP:369367512
2971+c, tdbSNP:148207079
2987+c, tdbSNP:201242310
3058+a, gdbSNP:149768800
3069+g, tdbSNP:147886477
3077+c, tdbSNP:141629313
3078+a, gdbSNP:147068787
3086+c, tdbSNP:200383522
3137+c, tdbSNP:201814836
3147+c, tdbSNP:375529059
3205+dbSNP:
3205+a, gdbSNP:368247409
3216+a, gdbSNP:372083317
3217+c, tdbSNP:200104182
3324+dbSNP:
3324+a, gdbSNP:149088443
3333+a, gdbSNP:143160271
3414+a, gdbSNP:200485103
3439+dbSNP:
3439+a, gdbSNP:372885044
3444+c, tdbSNP:141383715
3467+c, tdbSNP:145216125
3491+c, tdbSNP:147534464
3527+a, gdbSNP:375018737
3534+c, tdbSNP:369700472
3588+dbSNP:
3588+c, tdbSNP:202039332
3614+c, tdbSNP:373122915
3695+g, tdbSNP:377425535
3744+c, tdbSNP:370522595
3771+c, tdbSNP:370419567
3846+dbSNP:
3846+a, gdbSNP:374300363
3856+a, gdbSNP:200096403
3860+a, gdbSNP:137894484
3862+c, tdbSNP:368693886
3867+c, tdbSNP:115335139
3875+a, tdbSNP:372361923
3884+c, tdbSNP:149155949
3885+a, gdbSNP:373631162
3889+c, tdbSNP:367649187
3890+a, gdbSNP:200838638
3948+c, tdbSNP:376582167
3974+c, tdbSNP:371402264
3975+a, gdbSNP:185009718
4022+dbSNP:
4022+c, tdbSNP:374616111
4023+a, gdbSNP:139332716
4032+c, gdbSNP:374935528
4033+a, gdbSNP:369401044
4059+c, tdbSNP:372257661
4069+a, gdbSNP:372294386
4077+a, gdbSNP:149613080
complement(4078)-t, cdbSNP:1212934
4082+c, tdbSNP:144358189
4096+a, gdbSNP:375618779
4106+c, tdbSNP:369994002
4117+a, gdbSNP:374413723
4146+a, gdbSNP:377750684
4194+c, tdbSNP:200195292
4262+dbSNP:
4262+a, gdbSNP:373565478
4273+a, gdbSNP:368787343
4275+c, tdbSNP:371283114
4276+a, gdbSNP:374189635
4277+a, gdbSNP:148792547
4280+c, tdbSNP:142473307
4301+a, tdbSNP:368402363
4307+a, gdbSNP:373710119
4319+c, tdbSNP:147869980
4321+a, gdbSNP:367923884
4385+c, tdbSNP:139891048
4402+c, gdbSNP:189681080
4424+c, tdbSNP:141015952
4445+a, gdbSNP:149716961
4454+dbSNP:
4454+c, tdbSNP:35473255
4454+c, tdbSNP:386453147
4475+c, tdbSNP:148895205
4479+c, tdbSNP:368468093
4482+c, tdbSNP:201209045
4497+a, gdbSNP:3745234
4499+c, tdbSNP:61995685
4508+a, gdbSNP:372557198
4535+c, tdbSNP:376855081
4538+c, tdbSNP:370189807
4563+a, gdbSNP:373459551
4586+dbSNP:
4586+c, tdbSNP:34225188
4587+a, gdbSNP:369352974
4637+a, gdbSNP:183527379
4649+c, tdbSNP:150132353
4670+c, tdbSNP:144628745
4682+c, tdbSNP:112934297
4693+a, cdbSNP:148217267
4698+a, gdbSNP:141221243
4709+c, tdbSNP:377217717
4732+a, gdbSNP:150661961
4763+c, tdbSNP:371781628
4767+c, tdbSNP:374942873
4768+g, tdbSNP:138904325
4793+c, tdbSNP:369967292
4849+dbSNP:
4849+c, tdbSNP:147539384
4850+c, tdbSNP:139822806
4859+c, tdbSNP:145348824
4868+c, tdbSNP:371090576
4874+c, tdbSNP:138473998
4937+c, tdbSNP:148739946
4950+dbSNP:
4950+c, tdbSNP:142361779
4982+a, gdbSNP:151186249
5003+a, gdbSNP:201294981
5025+c, tdbSNP:200791026
5063+dbSNP:
5063+a, gdbSNP:140305632
5073..5074+, gdbSNP:35399265
5074+a, gdbSNP:372798483
5077+a, gdbSNP:375249697
5087+c, gdbSNP:201947104
5116+c, tdbSNP:144124759
5131+a, gdbSNP:397515427
5137+c, tdbSNP:376812395
5147+c, tdbSNP:149279834
5159+c, tdbSNP:200468005
5177+c, gdbSNP:77422116
5199+a, gdbSNP:375545228
5215+a, gdbSNP:141153248
5220+c, tdbSNP:144595008
5269+dbSNP:
5269+a, cdbSNP:138397020
5276+c, tdbSNP:35468447
5291+c, tdbSNP:143507034
5316+c, tdbSNP:371138631
5324+c, gdbSNP:148341236
5356+c, tdbSNP:200200636
5396+a, gdbSNP:372224111
5448+dbSNP:
5448+a, cdbSNP:373373576
5452+a, gdbSNP:143215498
5543+c, tdbSNP:185198604
5546+a, gdbSNP:377577186
5552+c, tdbSNP:190043758
5572+a, gdbSNP:367825461
5631+dbSNP:
5631+c, tdbSNP:113983707
5632+a, gdbSNP:371976691
5643+c, tdbSNP:375083726
5652+a, gdbSNP:369842921
5653+a, gdbSNP:372360723
5673+c, tdbSNP:147522761
5691+c, tdbSNP:139859934
5692+a, gdbSNP:201626121
complement(5706)-t, cdbSNP:1206038
5715+c, gdbSNP:150607375
5750+a, gdbSNP:112433681
5754+c, gdbSNP:149787596
5781+dbSNP:
5781+c, tdbSNP:373745990
5782+a, gdbSNP:183945597
5799+a, gdbSNP:376869149
5805+g, tdbSNP:370106282
5814+g, tdbSNP:144734416
5846+a, gdbSNP:139648725
5855+c, gdbSNP:377685078
5867+c, tdbSNP:370949857
5871+a, gdbSNP:375636196
5897+c, tdbSNP:370482940
5909+a, gdbSNP:116630802
5911+c, gdbSNP:373601254
5926+dbSNP:
5926+c, tdbSNP:139959427
5946+a, gdbSNP:200501111
5958+c, gdbSNP:143508185
5993+a, gdbSNP:36016565
6011..6012+, gdbSNP:34886828
6011+c, tdbSNP:151134622
6023+c, tdbSNP:371490515
6033+c, tdbSNP:373998831
6068+c, tdbSNP:62648096
6120+c, tdbSNP:150311870
6156+dbSNP:
6156+c, tdbSNP:144945446
6164+c, tdbSNP:369480415
6167+a, gdbSNP:138644598
6168+g, tdbSNP:371862361
6174+c, gdbSNP:147084460
6185+a, gdbSNP:200526872
6213+c, tdbSNP:368438075
6281+dbSNP:
6281+a, gdbSNP:369807153
6291+c, tdbSNP:34475546
6343+g, tdbSNP:200684391
6352+c, tdbSNP:371840641
6368+c, tdbSNP:200085640
6371+a, gdbSNP:200310970
6393+c, tdbSNP:144057511
6418+c, tdbSNP:374797693
6419+a, gdbSNP:143397959
6526+dbSNP:
6526+a, cdbSNP:377486370
6548+c, tdbSNP:369680099
6572+c, tdbSNP:148286629
6578+a, gdbSNP:141413149
6596+a, gdbSNP:200338219
6645+a, cdbSNP:202175287
6653+c, tdbSNP:373068327
6656+a, gdbSNP:150834651
6741+dbSNP:
6741+a, gdbSNP:368780512
6769+a, gdbSNP:139601509
6828+c, tdbSNP:371194840
6829+a, gdbSNP:201140958
6831+c, tdbSNP:373739098
6879+c, tdbSNP:367975745
6909+c, tdbSNP:201858033
6931+dbSNP:
6931+a, gdbSNP:370984978
6934+c, tdbSNP:372350131
6935+a, gdbSNP:145990797
complement(6953)-g, adbSNP:2288922
6954+c, tdbSNP:375806503
6959+c, tdbSNP:370110232
6996+a, gdbSNP:374088709
7009+c, tdbSNP:367956687
7010+a, gdbSNP:10425783
7046+c, tdbSNP:371268413
7057+c, tdbSNP:374178667
7058+c, tdbSNP:368865740
7093+dbSNP:
7093+a, gdbSNP:370288131
7103+c, tdbSNP:199937913
7121+c, tdbSNP:373665146
7130+c, tdbSNP:369775275
7139+c, tdbSNP:149735243
7154+c, tdbSNP:373527346
7167+c, gdbSNP:376399763
7186+c, tdbSNP:370225382
7187+a, gdbSNP:372437317
7199+c, tdbSNP:145630132
7204+a, gdbSNP:376007307
7231+c, tdbSNP:368451814
7234+a, gdbSNP:201847832
7255+a, gdbSNP:73554568
7290+dbSNP:
7290+c, tdbSNP:370379302
7322+c, tdbSNP:35019445
7344+a, gdbSNP:185811990
7354+g, tdbSNP:142506261
7365+c, tdbSNP:150940603
7368+a, gdbSNP:142042363
7381+a, gdbSNP:373842617
7405+a, gdbSNP:377068929
7409+g, tdbSNP:370364807
7452+dbSNP:
7452+g, tdbSNP:367851164
7475+c, tdbSNP:145886667
7476+a, gdbSNP:147708727
7481+c, tdbSNP:369359832
7482+a, gdbSNP:73033442
7487+c, tdbSNP:28483598
7488+a, gdbSNP:112167630
7496+c, tdbSNP:149439392
7510+a, gdbSNP:143643113
7523+c, tdbSNP:138235390
7529+c, tdbSNP:370715695
7550+c, gdbSNP:372380349
7591+dbSNP:
7591+c, tdbSNP:372558876
7648+c, tdbSNP:142829766
7706+dbSNP:
7706+c, g, tdbSNP:113822011
7707+a, gdbSNP:146094970
7730+c, tdbSNP:371582489
7734+a, gdbSNP:397515428
7745+c, tdbSNP:375011847
7760+c, tdbSNP:369521038
7769+c, gdbSNP:373259008
7841+a, gdbSNP:111595088
7855+a, gdbSNP:45623135
7865..7866+, tdbSNP:36086620
7892+c, tdbSNP:376414502
7902+c, tdbSNP:368024107
7910+a, gdbSNP:199786210
7917+a, gdbSNP:376078071
7968+a, gdbSNP:150782421
7975+a, gdbSNP:369692848
7994+c, tdbSNP:373059614
8001+a, gdbSNP:139192223
8008+a, tdbSNP:377601737
8037+c, gdbSNP:149965041
8094+g, tdbSNP:112469278
8107+c, tdbSNP:147216997
8139+a, gdbSNP:147133204
8147+a, gdbSNP:200748447
8148+c, tdbSNP:374292471
8158+c, tdbSNP:368743788
8165+c, tdbSNP:3745237
8171+a, gdbSNP:78335246
8177+a, gdbSNP:144256916
8185+c, tdbSNP:372348183
8196+a, gdbSNP:147796963
8207+c, tdbSNP:375633770
8208+a, gdbSNP:148860986
8211+c, tdbSNP:367639760
8212+a, gdbSNP:371459258
8219+g, tdbSNP:374927201
8220+a, cdbSNP:140517402
8240+a, cdbSNP:369259843
8296+a, gdbSNP:140588377
8310+a, gdbSNP:200506642
8327+c, tdbSNP:150486662
8355+a, cdbSNP:375577811
8394+a, gdbSNP:373377277
8476+a, gdbSNP:199675024
8484+c, tdbSNP:377748543
8518+a, gdbSNP:370389657
8519+, cdbSNP:35869141
8556+a, cdbSNP:373293709
8566+c, tdbSNP:377485395
8567+a, gdbSNP:370578585
8573+c, tdbSNP:199681302
8603+c, tdbSNP:138179740
8610+c, tdbSNP:141224456
8771+c, tdbSNP:115428796
8780+a, gdbSNP:371296750
8807+c, tdbSNP:374532854
8860+a, gdbSNP:11881304
8867+c, tdbSNP:371191311
8880+g, tdbSNP:373738711
8881+g, tdbSNP:367932670
8885..8886+, gdbSNP:36092031
8889+c, gdbSNP:369099717
8912+a, gdbSNP:371666486
8942+c, tdbSNP:374681560
8950+a, cdbSNP:61978610
8996+a, gdbSNP:183763590
9000+c, tdbSNP:201280861
9029+c, tdbSNP:186608346
9083+, cdbSNP:34892701
9145+c, tdbSNP:76737545
9178+a, gdbSNP:113687701
9184+c, tdbSNP:75698590
9226+a, cdbSNP:140158124
9250+a, gdbSNP:117510235
9276+c, tdbSNP:7248473
9336+a, gdbSNP:373162589
9343+c, gdbSNP:376937334
9378+a, gdbSNP:370226063
9424+a, gdbSNP:191467722
9478+a, gdbSNP:373032041
9545+a, gdbSNP:149900703
9672+a, gdbSNP:377660370
9858..9859+, tdbSNP:34366582
9877+a, gdbSNP:113078604
9892+a, gdbSNP:370554126
9925+a, cdbSNP:375170891
9950+c, tdbSNP:182796455
10037+c, tdbSNP:140796510
10038+a, gdbSNP:186938488
10129+a, gdbSNP:191355802
10137+a, gdbSNP:145916665
10140+a, gdbSNP:77151871
10281+a, tdbSNP:138454226
10418+c, tdbSNP:28572784
10426+g, tdbSNP:74859271
10472+a, gdbSNP:183496152
10528+c, tdbSNP:112456113
10594+a, gdbSNP:45444992
10621+c, tdbSNP:11878207
10625+c, tdbSNP:187974955
10629+g, tdbSNP:117935336
10653+c, gdbSNP:370185775
10661+c, tdbSNP:372584932
10673+c, tdbSNP:1053626
10690+a, gdbSNP:377178491
complement(10711)-g, adbSNP:2304211
10756+c, tdbSNP:1053629
10772+c, tdbSNP:1053630
10824+c, gdbSNP:11878297
complement(10875)-, tdbSNP:3214618
10894+a, gdbSNP:1053632
complement(10898)-g, adbSNP:2304210
10911+a, gdbSNP:143324344
Gene SymbolMEGF8
Gene SynonymC19orf49; CRPT2; EGFL4; SBP1
Chromosome19
Locus Map19q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001410 Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 2, mRNA. On-demand $4749.00 40
NM_001271938 Homo sapiens multiple EGF-like-domains 8 (MEGF8), transcript variant 1, mRNA. On-demand $4749.00 40
Title Mutations in multidomain protein MEGF8 identify a Carpenter syndrome subtype associated with defective lateralization .
Author Twigg SR, Lloyd D, Jenkins D, Elcioglu NE, Cooper CD, Al-Sannaa N, Annagur A, Gillessen-Kaesbach G, Huning I, Knight SJ, Goodship JA, Keavney BD, Beales PL, Gileadi O, McGowan SJ and Wilkie AO.
Journal Am. J. Hum. Genet. 91 (5), 897-905 (2012)
Title Large-scale proteomics and phosphoproteomics of urinary exosomes .
Author Gonzales PA, Pisitkun T, Hoffert JD, Tchapyjnikov D, Star RA, Kleta R, Wang NS and Knepper MA.
Journal J. Am. Soc. Nephrol. 20 (2), 363-379 (2009)
Title Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening .
Author Nakayama M, Nakajima D, Nagase T, Nomura N, Seki N and Ohara O.
Journal Genomics 51 (1), 27-34 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.