• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001419 Homo sapiens ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_001419.2, 38201713
Length 6075 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), mRNA.
Product ELAV-like protein 1
Comment

Summary: The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3' untranslated regions of mRNAs. AREs signal degradation of mRNAs as a means to regulate gene expression, thus by binding AREs, the ELAVL family of proteins play a role in stabilizing ARE-containing mRNAs. This gene has been implicated in a variety of biological processes and has been linked to a number of diseases, including cancer. It is highly expressed in many cancers, and could be potentially useful in cancer diagnosis, prognosis, and therapy. [provided by RefSeq, Sep 2012].

RefSeq NP_001410.2
CDS 168..1148
Misc Feature(1)171..173
Misc Feature(2)171..173
Misc Feature(3)171..173
Misc Feature(4)222..1145
Misc Feature(5)228..452
Misc Feature(6)order(234..236,354..356,360..362)
Misc Feature(7)444..452
Misc Feature(8)486..716
Misc Feature(9)order(492..494,612..614,618..620)
Misc Feature(10)708..716
Misc Feature(11)756..758
Misc Feature(12)765..767
Misc Feature(13)765..767
Misc Feature(14)771..773
Misc Feature(15)771..773
Misc Feature(16)816..818
Misc Feature(17)816..818
Misc Feature(18)900..1124
Misc Feature(19)order(906..908,1026..1028,1032..1034)
Misc Feature(20)1116..1124
Exon (1)1..151
Gene:ELAVL1
Gene Synonym:ELAV1; Hua; HUR; MelG
Exon (2)152..339
Gene:ELAVL1
Gene Synonym:ELAV1; Hua; HUR; MelG
Exon (3)340..443
Gene:ELAVL1
Gene Synonym:ELAV1; Hua; HUR; MelG
Exon (4)444..597
Gene:ELAVL1
Gene Synonym:ELAV1; Hua; HUR; MelG
Exon (5)598..823
Gene:ELAVL1
Gene Synonym:ELAV1; Hua; HUR; MelG
Exon (6)824..6058
Gene:ELAVL1
Gene Synonym:ELAV1; Hua; HUR; MelG
Translation MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHS LGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQK DVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPIT VKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNA SSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM AIASLNGYRLGDKILQVSFKTNKSHK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(49)-dbSNP:
complement(49)-t, gdbSNP:189171866
complement(164)-dbSNP:
complement(164)-t, adbSNP:2113116
complement(213)-c, adbSNP:183919265
complement(227)-t, cdbSNP:142415817
complement(326)-g, cdbSNP:138730200
complement(356)-dbSNP:
complement(356)-t, cdbSNP:1127943
complement(398)-t, cdbSNP:188279033
complement(413)-g, adbSNP:201603573
complement(482)-dbSNP:
complement(482)-g, adbSNP:114408443
complement(506)-g, adbSNP:192725189
complement(509)-g, cdbSNP:41379445
complement(527)-t, cdbSNP:45483997
complement(550)-t, cdbSNP:140179606
complement(559)-t, cdbSNP:201280427
complement(612)-dbSNP:
complement(612)-g, adbSNP:11542499
complement(626)-g, cdbSNP:147459374
complement(638)-c, adbSNP:149337587
complement(725)-g, adbSNP:201498939
complement(810)-g, cdbSNP:138823708
complement(839)-dbSNP:
complement(839)-g, adbSNP:186814941
complement(866)-g, adbSNP:200745899
complement(884)-g, adbSNP:202134359
complement(887)-g, adbSNP:150631425
complement(893)-g, adbSNP:182490610
complement(932)-g, adbSNP:141885519
complement(933)-t, cdbSNP:148254612
complement(935)-g, adbSNP:145371492
complement(971)-t, cdbSNP:14394
complement(974)-g, adbSNP:141157314
complement(1061)-g, adbSNP:138089315
complement(1065)-t, adbSNP:199976454
complement(1073)-t, adbSNP:117307819
complement(1151)-g, adbSNP:186880346
complement(1203)-t, cdbSNP:183528970
complement(1375..1376)-, adbSNP:34785543
complement(1573)-g, adbSNP:79721943
complement(1603)-t, cdbSNP:192158618
complement(1731)-t, gdbSNP:75744398
complement(1753)-g, adbSNP:4804056
complement(1761)-c, adbSNP:12982225
complement(1768)-g, adbSNP:186475212
complement(1912)-t, gdbSNP:74369359
complement(2198)-c, adbSNP:10818
complement(2282)-g, adbSNP:14610
complement(2439)-g, cdbSNP:180688056
complement(2450)-t, cdbSNP:112243720
complement(2460)-t, gdbSNP:4804244
complement(2575)-c, adbSNP:188282540
complement(2619)-t, cdbSNP:12973935
complement(2640)-t, cdbSNP:143118673
complement(2710)-t, cdbSNP:148611610
complement(2716)-g, adbSNP:185439379
complement(2733)-c, adbSNP:145885267
complement(2827)-g, adbSNP:181204020
complement(2966)-g, adbSNP:12985234
complement(3069)-t, cdbSNP:10402477
complement(3097)-g, adbSNP:35986520
complement(3258..3285)-, cttctgatggaaggtgggagccaacaccdbSNP:71165244
complement(3318)-g, adbSNP:73008891
complement(3345)-t, cdbSNP:78548450
complement(3352)-g, adbSNP:149846894
complement(3353..3354)-, gdbSNP:34406115
complement(3449)-g, adbSNP:116398041
complement(3584)-t, cdbSNP:77312432
complement(3595)-g, adbSNP:139908588
complement(3596)-g, adbSNP:147291118
complement(3758)-g, adbSNP:189658634
complement(3800)-g, adbSNP:112011167
complement(3900)-g, cdbSNP:143921406
complement(4024)-t, cdbSNP:12983784
complement(4086)-c, adbSNP:73923951
complement(4125)-c, adbSNP:78577110
complement(4156)-c, adbSNP:185133870
complement(4264)-, cdbSNP:34888054
complement(4415)-t, gdbSNP:77775659
complement(4417)-g, adbSNP:192920526
complement(4497..4498)-, aagdbSNP:200747424
complement(4504)-g, adbSNP:3745391
complement(4589)-t, cdbSNP:189143756
complement(4633)-t, gdbSNP:147458010
complement(4635)-g, adbSNP:184690108
complement(4738)-g, adbSNP:192658356
complement(4830)-g, cdbSNP:186610101
complement(4831)-t, gdbSNP:2042920
complement(4861)-g, adbSNP:141440324
complement(4916)-g, adbSNP:17160080
complement(4993)-g, cdbSNP:73008886
complement(5026)-g, adbSNP:116715205
complement(5040)-g, adbSNP:182688677
complement(5044)-t, gdbSNP:148294983
complement(5077)-t, adbSNP:192857836
complement(5086)-, adbSNP:71707759
complement(5099)-g, adbSNP:200286505
complement(5127)-t, cdbSNP:144173354
complement(5199..5200)-, aadbSNP:148070294
complement(5208)-t, gdbSNP:7254797
complement(5228)-g, adbSNP:149529344
complement(5354)-g, adbSNP:62123115
complement(5519)-, tdbSNP:199580649
complement(5527)-g, adbSNP:188045007
complement(5562)-t, adbSNP:12975506
complement(5567)-t, adbSNP:76513943
complement(5573)-, adbSNP:5826992
complement(5828)-g, adbSNP:138043782
complement(5830)-t, cdbSNP:191598501
complement(5944)-t, cdbSNP:117179851
complement(5983)-g, adbSNP:145411192
Gene SymbolELAVL1
Gene SynonymELAV1; Hua; HUR; MelG
Chromosome19
Locus Map19p13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001419 Homo sapiens ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), mRNA. In-stock $418.00 $369.00 10
Title Role of transcription factor Sp1 and RNA binding protein HuR in the downregulation of Dr+ Escherichia coli receptor protein decay accelerating factor (DAF or CD55) by nitric oxide .
Author Banadakoppa,M., Liebenthal,D., Nowak,D.E., Urvil,P., Yallampalli,U., Wilson,G.M., Kishor,A. and Yallampalli,C.
Journal FEBS J. 280 (3), 840-854 (2013)
Title The mRNA-stabilizing factor HuR protein is targeted by beta-TrCP protein for degradation in response to glycolysis inhibition .
Author Chu,P.C., Chuang,H.C., Kulp,S.K. and Chen,C.S.
Journal J. Biol. Chem. 287 (52), 43639-43650 (2012)
Title HuR posttranscriptionally regulates early growth response-1 (Egr-1) expression at the early stage of T cell activation .
Author Mou,Z., You,J., Xiao,Q., Wei,Y., Yuan,J., Liu,Y., Brewer,G. and Ma,W.J.
Journal FEBS Lett. 586 (24), 4319-4325 (2012)
Title Insights from the HuR-interacting transcriptome: ncRNAs, ubiquitin pathways, and patterns of secondary structure dependent RNA interactions .
Author St Laurent,G. III, Shtokalo,D., Heydarian,M., Palyanov,A., Babiy,D., Zhou,J., Kumar,A. and Urcuqui-Inchima,S.
Journal Mol. Genet. Genomics 287 (11-12), 867-879 (2012)
Title HuR is necessary for mammary epithelial cell proliferation and polarity at least in part via DeltaNp63 .
Author Yan,W., Zhang,Y., Zhang,J., Cho,S.J. and Chen,X.
Journal PLoS ONE 7 (9), E45336 (2012)
Title Purification and characterization of beta-adrenergic receptor mRNA-binding proteins .
Author Blaxall,B.C., Pellett,A.C., Wu,S.C., Pende,A. and Port,J.D.
Journal J. Biol. Chem. 275 (6), 4290-4297 (2000)
Title HuR regulates p21 mRNA stabilization by UV light .
Author Wang,W., Furneaux,H., Cheng,H., Caldwell,M.C., Hutter,D., Liu,Y., Holbrook,N. and Gorospe,M.
Journal Mol. Cell. Biol. 20 (3), 760-769 (2000)
Title Analysis of the RNA recognition motifs of human neuronal ELAV-like proteins in binding to a cytokine mRNA .
Author Sakai,K., Kitagawa,Y. and Hirose,G.
Journal Biochem. Biophys. Res. Commun. 256 (2), 263-268 (1999)
Title Localization of the human HuR gene to chromosome 19p13.2 .
Author Ma,W.J. and Furneaux,H.
Journal Hum. Genet. 99 (1), 32-33 (1997)
Title Cloning and characterization of HuR, a ubiquitously expressed Elav-like protein .
Author Ma,W.J., Cheng,S., Campbell,C., Wright,A. and Furneaux,H.
Journal J. Biol. Chem. 271 (14), 8144-8151 (1996)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.