• THAT   AND
  • THAT   AND


Homo sapiens engrailed homeobox 1 (EN1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001426 Homo sapiens engrailed homeobox 1 (EN1), mRNA. Full Lenth $858.98
ORF Sequence $341.91


RefSeq Version NM_001426.3, 126090908
Length 2962 bp
Structure linear
Update Date 11-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens engrailed homeobox 1 (EN1), mRNA.
Product homeobox protein engrailed-1
Comment

Summary: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq].

RefSeq NP_001417.3
CDS 1017..2195
Exon (1)1..1878
Exon (2)1..1878
Exon (3)1879..2962
Translation MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPP AAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKE QPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPP DGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGT KYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNE KEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKK ATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(174)-g, cdbSNP:11123496
complement(206)-g, adbSNP:13431464
427+, adbSNP:70949945
435+a, cdbSNP:3754856
complement(440)-t, gdbSNP:112793435
complement(441)-t, gdbSNP:111424175
443+a, cdbSNP:3754857
complement(457)-t, gdbSNP:4989649
complement(738)-t, cdbSNP:111622005
1505+a, gdbSNP:79126103
1637+c, gdbSNP:77704181
1786+a, tdbSNP:78210121
2045+c, tdbSNP:76483309
complement(2084)-t, gdbSNP:79784675
complement(2090)-t, gdbSNP:79213977
complement(2124)-g, adbSNP:72955069
complement(2235)-t, gdbSNP:117861944
complement(2353)-c, adbSNP:61734176
complement(2582)-c, adbSNP:35383982
complement(2640..2641)-, tdbSNP:71805137
complement(2641..2642)-, tdbSNP:61275212
complement(2641)-t, gdbSNP:111662957
complement(2661..2839)-, largedeletiondbSNP:71763592
complement(2684)-t, cdbSNP:114632569
complement(2920)-g, adbSNP:55990007
Gene SymbolEN1
Gene SynonymEN1
Chromosome2
Locus Map2q14.2
All Transcripts NM_001426
Title Replication of top markers of a genome-wide association study in multiple sclerosis in Spain .
Author Cavanillas,M.L., Fernandez,O., Comabella,M., Alcina,A., Fedetz,M., Izquierdo,G., Lucas,M., Cenit,M.C., Arroyo,R., Vandenbroeck,K., Alloza,I., Garcia-Barcina,M., Antiguedad,A., Leyva,L., Gomez,C.L., Olascoaga,J., Otaegui,D., Blanco,Y., Saiz,A., Montalban,X., Matesanz,F. and Urcelay,E.
Journal Genes Immun. 12 (2), 110-115 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men .
Author Yerges,L.M., Klei,L., Cauley,J.A., Roeder,K., Kammerer,C.M., Moffett,S.P., Ensrud,K.E., Nestlerode,C.S., Marshall,L.M., Hoffman,A.R., Lewis,C., Lang,T.F., Barrett-Connor,E., Ferrell,R.E., Orwoll,E.S. and Zmuda,J.M.
Journal J. Bone Miner. Res. 24 (12), 2039-2049 (2009)
Title Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip .
Author Talmud,P.J., Drenos,F., Shah,S., Shah,T., Palmen,J., Verzilli,C., Gaunt,T.R., Pallas,J., Lovering,R., Li,K., Casas,J.P., Sofat,R., Kumari,M., Rodriguez,S., Johnson,T., Newhouse,S.J., Dominiczak,A., Samani,N.J., Caulfield,M., Sever,P., Stanton,A., Shields,D.C., Padmanabhan,S., Melander,O., Hastie,C., Delles,C., Ebrahim,S., Marmot,M.G., Smith,G.D., Lawlor,D.A., Munroe,P.B., Day,I.N., Kivimaki,M., Whittaker,J., Humphries,S.E. and Hingorani,A.D.
Journal Am. J. Hum. Genet. 85 (5), 628-642 (2009)
Title Long-range epigenetic silencing at 2q14.2 affects most human colorectal cancers and may have application as a non-invasive biomarker of disease .
Author Mayor,R., Casadome,L., Azuara,D., Moreno,V., Clark,S.J., Capella,G. and Peinado,M.A.
Journal Br. J. Cancer 100 (10), 1534-1539 (2009)
Title The mouse Engrailed-1 gene and ventral limb patterning .
Author Loomis,C.A., Harris,E., Michaud,J., Wurst,W., Hanks,M. and Joyner,A.L.
Journal Nature 382 (6589), 360-363 (1996)
Title Deregulated expression of PAX5 in medulloblastoma .
Author Kozmik,Z., Sure,U., Ruedi,D., Busslinger,M. and Aguzzi,A.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (12), 5709-5713 (1995)
Title Regional assignment of the human homeobox-containing gene EN1 to chromosome 2q13-q21 .
Author Kohler,A., Logan,C., Joyner,A.L. and Muenke,M.
Journal Genomics 15 (1), 233-235 (1993)
Title Cloning and sequence comparison of the mouse, human, and chicken engrailed genes reveal potential functional domains and regulatory regions .
Author Logan,C., Hanks,M.C., Noble-Topham,S., Nallainathan,D., Provart,N.J. and Joyner,A.L.
Journal Dev. Genet. 13 (5), 345-358 (1992)
Title Chromosomal localization of the human homeo box-containing genes, EN1 and EN2 .
Author Logan,C., Willard,H.F., Rommens,J.M. and Joyner,A.L.
Journal Genomics 4 (2), 206-209 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878