• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens engrailed homeobox 1 (EN1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001426 Homo sapiens engrailed homeobox 1 (EN1), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001426.3, 126090908
Length 2962 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens engrailed homeobox 1 (EN1), mRNA.
Product homeobox protein engrailed-1
Comment

Summary: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq, Jul 2008].

RefSeq NP_001417.3
CDS 1017..2195
Misc Feature(1)897..899
Misc Feature(2)1923..2102
Misc Feature(3)1923..2102
Misc Feature(4)1929..2096
Misc Feature(5)order(1929..1940,1944..1946,1995..1997,2013..2015,
Misc Feature(6)order(1932..1934,1941..1943,2061..2063,2070..2075,
Misc Feature(7)2097..2192
Exon (1)1..1878
Gene:EN1
Gene Synonym:EN1
Exon (2)1879..2962
Gene:EN1
Gene Synonym:EN1
Translation MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPP AAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKE QPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPP DGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGT KYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNE KEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKK ATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(30)-dbSNP:
complement(30)-t, gdbSNP:369695233
complement(174)-g, cdbSNP:11123496
complement(206)-g, adbSNP:13431464
complement(383)-, adbSNP:200885683
427+, adbSNP:70949945
435+a, cdbSNP:3754856
complement(440)-t, gdbSNP:112793435
complement(441)-t, gdbSNP:111424175
443+a, cdbSNP:3754857
complement(457)-t, gdbSNP:4989649
complement(458..459)-, gdbSNP:148664471
complement(515)-t, cdbSNP:189421997
complement(619..620)-, aadbSNP:370345047
complement(689..692)-, gaagdbSNP:377140834
complement(738)-t, cdbSNP:111622005
complement(859)-t, cdbSNP:371365220
complement(1242)-t, gdbSNP:185308608
complement(1261)-g, adbSNP:372072112
complement(1277)-c, adbSNP:368360681
complement(1383)-g, adbSNP:374171748
complement(1421)-t, gdbSNP:145197387
complement(1461)-t, cdbSNP:372175487
complement(1485)-g, adbSNP:367875317
1505+a, gdbSNP:79126103
complement(1514)-g, adbSNP:370114691
complement(1524)-t, gdbSNP:376499328
complement(1529)-g, adbSNP:375477142
complement(1530)-c, adbSNP:370998698
1637+c, gdbSNP:77704181
complement(1727)-c, adbSNP:377373176
complement(1744)-g, adbSNP:368224377
complement(1758)-g, cdbSNP:374023978
complement(1761)-c, adbSNP:201974100
1786+a, tdbSNP:78210121
complement(1787)-g, adbSNP:377545740
complement(1790)-t, gdbSNP:373469424
complement(1814)-c, adbSNP:368737948
complement(1896)-dbSNP:
complement(1896)-g, cdbSNP:375974616
complement(1913)-g, adbSNP:369801550
complement(1928)-t, cdbSNP:150977527
complement(1940)-g, adbSNP:139728151
complement(1966)-t, cdbSNP:145326362
complement(1979)-t, cdbSNP:370594131
complement(2021)-g, cdbSNP:367986532
complement(2027)-g, adbSNP:374991047
2045+c, tdbSNP:76483309
complement(2078)-t, cdbSNP:370237510
complement(2079)-t, gdbSNP:200272085
complement(2105)-t, gdbSNP:201019085
complement(2114)-g, adbSNP:139806570
complement(2124)-g, adbSNP:72955069
complement(2184)-t, cdbSNP:200716631
complement(2209)-c, adbSNP:371520426
complement(2218)-g, adbSNP:368544860
complement(2254)-t, cdbSNP:189344595
complement(2264)-t, adbSNP:373562729
complement(2268)-t, cdbSNP:148242115
complement(2325)-t, cdbSNP:372423682
complement(2353)-c, adbSNP:61734176
complement(2475)-t, gdbSNP:185363430
complement(2536)-t, adbSNP:180695746
complement(2582)-c, adbSNP:35383982
complement(2584)-t, cdbSNP:189453257
complement(2640..2641)-, tdbSNP:71805137
complement(2641..2642)-, tdbSNP:61275212
complement(2641)-t, gdbSNP:111662957
complement(2684)-t, cdbSNP:184945714
complement(2692)-c, adbSNP:373008661
complement(2712)-c, adbSNP:143139406
complement(2920)-g, adbSNP:55990007
Gene SymbolEN1
Gene SynonymEN1
Chromosome2
Locus Map2q14.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001426 Homo sapiens engrailed homeobox 1 (EN1), mRNA. On-demand TBD TBD
Title Developmental transcription factor EN1--a novel biomarker in human salivary gland adenoid cystic carcinoma .
Author Bell D, Bell A, Roberts D, Weber RS and El-Naggar AK.
Journal Cancer 118 (5), 1288-1292 (2012)
Title [The regulation of UTROPHIN expression by EN1] .
Author Wang Q, Cao DH, Lin CK, Wang ZD, Cui WT and Jin CL.
Journal Yi Chuan 33 (4), 347-352 (2011)
Title Replication of top markers of a genome-wide association study in multiple sclerosis in Spain .
Author Cavanillas ML, Fernandez O, Comabella M, Alcina A, Fedetz M, Izquierdo G, Lucas M, Cenit MC, Arroyo R, Vandenbroeck K, Alloza I, Garcia-Barcina M, Antiguedad A, Leyva L, Gomez CL, Olascoaga J, Otaegui D, Blanco Y, Saiz A, Montalban X, Matesanz F and Urcelay E.
Journal Genes Immun. 12 (2), 110-115 (2011)
Title A method of utrophin up-regulation through RNAi-mediated knockdown of the transcription factor EN1 .
Author Wang Q, Cao DH, Jin CL, Lin CK, Ma HW and Wu YY.
Journal J. Int. Med. Res. 39 (1), 161-171 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B, Yusuf S, Gerstein HC, Engert JC and Anand S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title The mouse Engrailed-1 gene and ventral limb patterning .
Author Loomis CA, Harris E, Michaud J, Wurst W, Hanks M and Joyner AL.
Journal Nature 382 (6589), 360-363 (1996)
Title Deregulated expression of PAX5 in medulloblastoma .
Author Kozmik Z, Sure U, Ruedi D, Busslinger M and Aguzzi A.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (12), 5709-5713 (1995)
Title Regional assignment of the human homeobox-containing gene EN1 to chromosome 2q13-q21 .
Author Kohler A, Logan C, Joyner AL and Muenke M.
Journal Genomics 15 (1), 233-235 (1993)
Title Cloning and sequence comparison of the mouse, human, and chicken engrailed genes reveal potential functional domains and regulatory regions .
Author Logan C, Hanks MC, Noble-Topham S, Nallainathan D, Provart NJ and Joyner AL.
Journal Dev. Genet. 13 (5), 345-358 (1992)
Title Chromosomal localization of the human homeo box-containing genes, EN1 and EN2 .
Author Logan C, Willard HF, Rommens JM and Joyner AL.
Journal Genomics 4 (2), 206-209 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.