• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens engrailed homeobox 2 (EN2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001427 Homo sapiens engrailed homeobox 2 (EN2), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001427.3, 126090912
Length 3405 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens engrailed homeobox 2 (EN2), mRNA.
Product homeobox protein engrailed-2
Comment

Summary: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq, Jul 2008].

RefSeq NP_001418.2
CDS 250..1251
Misc Feature(1)97..99
Misc Feature(2)97..99
Misc Feature(3)976..1155
Misc Feature(4)976..1155
Misc Feature(5)982..1152
Misc Feature(6)order(982..996,1000..1002,1051..1053,1069..1071,
Misc Feature(7)order(988..990,997..999,1117..1119,1126..1131,1138..1140)
Misc Feature(8)1075..1077
Misc Feature(9)1153..1248
Exon (1)935..3395
Gene:EN2
Gene Synonym:EN2
Translation MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNH QHPHRITNFFIDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQ LLGSGSREPRQNPPCAPGAGGPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGS LKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNP NKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIK KATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
102+c, tdbSNP:371410446
210+g, tdbSNP:370541113
277+c, gdbSNP:193264681
360+a, gdbSNP:77846527
397+c, gdbSNP:377588499
420+c, gdbSNP:199573836
585+c, gdbSNP:377426405
complement(610)-g, adbSNP:3735653
633+a, gdbSNP:375042010
653+g, tdbSNP:112029171
849+c, gdbSNP:80239010
969+a, gdbSNP:145749730
976+a, gdbSNP:371468430
986+g, tdbSNP:148967146
987+g, tdbSNP:144197066
990+a, gdbSNP:138007513
1006+g, tdbSNP:75103128
1032+c, tdbSNP:373725366
1059+a, gdbSNP:112687347
1067+a, gdbSNP:367902456
1083+a, gdbSNP:146535449
1125+c, gdbSNP:141222652
1137+c, tdbSNP:145531356
1149+a, gdbSNP:34614453
1158+a, gdbSNP:148064651
1173+a, gdbSNP:140822188
1179+c, g, tdbSNP:56008230
1201+c, tdbSNP:2361689
1209+c, tdbSNP:142774508
1236+c, gdbSNP:374787499
1238+c, tdbSNP:367924841
1245+c, tdbSNP:149481945
1254+c, tdbSNP:12674067
1255+a, gdbSNP:375061145
1284+c, tdbSNP:369675027
1285+a, gdbSNP:192274449
1318+g, tdbSNP:184624346
1344+c, tdbSNP:374181653
1506+a, gdbSNP:73734533
1634+c, tdbSNP:189436701
1660+c, tdbSNP:181376144
1670+c, gdbSNP:207468873
1770+c, gdbSNP:185936495
1776+a, gdbSNP:368761266
1825+c, tdbSNP:372780297
1828+c, gdbSNP:368291486
1851+, gdbSNP:144219267
1861+a, gdbSNP:56651365
1874+g, tdbSNP:143878581
complement(1876)-g, adbSNP:3808330
complement(1955)-t, cdbSNP:3808329
1964+c, tdbSNP:189617846
complement(1981)-g, adbSNP:3808328
2001+c, tdbSNP:10234087
2019..2022+, ctttdbSNP:111556743
2022..2025+, tcttdbSNP:371995609
2060+c, tdbSNP:139789685
complement(2069)-g, adbSNP:3808327
2075..2076+ct, tcdbSNP:386719925
2075+c, tdbSNP:55729502
complement(2076)-g, adbSNP:3808326
2131+a, tdbSNP:57599144
2159+a, cdbSNP:375798987
2186+, cdbSNP:113000817
2206+c, tdbSNP:370047096
2217+c, tdbSNP:143914514
2235+a, gdbSNP:368877872
2244+c, tdbSNP:4716597
2266+c, tdbSNP:181828936
2267+a, gdbSNP:369546982
2380+g, tdbSNP:114134796
2446+a, tdbSNP:67027007
2530+a, gdbSNP:186374442
2549+c, tdbSNP:10949811
2560..2563+, acacdbSNP:144874127
2581..2582+, a, ac, acadbSNP:35869460
2581+a, cdbSNP:77385528
2582..2583+, acadbSNP:72022210
2583..2584+, acdbSNP:113684257
2584+a, cdbSNP:200149777
2711+c, tdbSNP:190966205
2733+c, tdbSNP:117213382
2895+a, gdbSNP:370953015
2925+c, tdbSNP:182759274
3044+c, tdbSNP:118079538
3124+c, tdbSNP:146402842
3222..3223+, atdbSNP:371338740
3238..3239+, cdbSNP:34901594
3264+c, tdbSNP:139745969
3276+g, tdbSNP:186998101
3299+c, tdbSNP:115156116
3320+c, tdbSNP:373820948
3381+c, tdbSNP:56178493
Gene SymbolEN2
Gene SynonymEN2
Chromosome7
Locus Map7q36
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001427 Homo sapiens engrailed homeobox 2 (EN2), mRNA. On-demand TBD TBD
Title Expression of Engrailed-2 (EN2) protein in bladder cancer and its potential utility as a urinary diagnostic biomarker .
Author Morgan R, Bryan RT, Javed S, Launchbury F, Zeegers MP, Cheng KK, James ND, Wallace DM, Hurst CD, Ward DG, Knowles MA and Pandha H.
Journal Eur. J. Cancer 49 (9), 2214-2222 (2013)
Title Role of Engrailed-2 (EN2) as a prostate cancer detection biomarker in genetically high risk men .
Author Killick E, Morgan R, Launchbury F, Bancroft E, Page E, Castro E, Kote-Jarai Z, Aprikian A, Blanco I, Clowes V, Domchek S, Douglas F, Eccles D, Evans DG, Harris M, Kirk J, Lam J, Lindeman G, Mitchell G, Pachter N, Selkirk C, Tucker K, Zgajnar J, Eeles R and Pandha H.
Journal Sci Rep 3, 2059 (2013)
Title Complex epigenetic regulation of engrailed-2 (EN-2) homeobox gene in the autism cerebellum .
Author James SJ, Shpyleva S, Melnyk S, Pavliv O and Pogribny IP.
Journal Transl Psychiatry 3, E232 (2013)
Title The WNT2 gene polymorphism associated with speech delay inherent to autism .
Author Lin PI, Chien YL, Wu YY, Chen CH, Gau SS, Huang YS, Liu SK, Tsai WC and Chiu YN.
Journal Res Dev Disabil 33 (5), 1533-1540 (2012)
Title Cut-like homeobox 1 and nuclear factor I/B mediate ENGRAILED2 autism spectrum disorder-associated haplotype function .
Author Choi J, Ababon MR, Matteson PG and Millonig JH.
Journal Hum. Mol. Genet. 21 (7), 1566-1580 (2012)
Title Deregulated expression of PAX5 in medulloblastoma .
Author Kozmik Z, Sure U, Ruedi D, Busslinger M and Aguzzi A.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (12), 5709-5713 (1995)
Title Cloning and sequence comparison of the mouse, human, and chicken engrailed genes reveal potential functional domains and regulatory regions .
Author Logan C, Hanks MC, Noble-Topham S, Nallainathan D, Provart NJ and Joyner AL.
Journal Dev. Genet. 13 (5), 345-358 (1992)
Title Subtle cerebellar phenotype in mice homozygous for a targeted deletion of the En-2 homeobox .
Author Joyner AL, Herrup K, Auerbach BA, Davis CA and Rossant J.
Journal Science 251 (4998), 1239-1243 (1991)
Title Isolation and chromosomal localization of the human En-2 gene .
Author Poole SJ, Law ML, Kao FT and Lau YF.
Journal Genomics 4 (3), 225-231 (1989)
Title Chromosomal localization of the human homeo box-containing genes, EN1 and EN2 .
Author Logan C, Willard HF, Rommens JM and Joyner AL.
Journal Genomics 4 (2), 206-209 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.