• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant a, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001437 Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant a, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_001437.2, 94538323
Length 2169 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant a, mRNA.
Product estrogen receptor beta isoform 1
Comment

Summary: This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (a), also known as 1, encodes the longest isoform (1).

RefSeq NP_001428.1
CDS 469..2061
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)64
Misc Feature(4)287
Misc Feature(5)403..405
Misc Feature(6)469..912
Misc Feature(7)469..912
Misc Feature(8)532..840
Misc Feature(9)727..729
Misc Feature(10)781..783
Misc Feature(11)898..1143
Misc Feature(12)order(913..915,922..924,964..966,973..975,1021..1023,
Misc Feature(13)order(940..951,967..972,976..984,988..993,1060..1065,
Misc Feature(14)order(1018..1029,1039..1044,1057..1059,1066..1068)
Misc Feature(15)1111..2058
Misc Feature(16)1255..1962
Misc Feature(17)order(1360..1362,1375..1377,1381..1383,1483..1485,
Misc Feature(18)order(1396..1398,1408..1410,1447..1452,1462..1464,
Misc Feature(19)order(1675..1677,1687..1689,1693..1698,1756..1758,
Exon (1)1..378
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (2)379..830
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (3)831..1003
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (4)1004..1120
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (5)1121..1420
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (6)1421..1559
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (7)1560..1693
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (8)1694..1874
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (9)1875..2169
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Translation MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-g, cdbSNP:145304885
complement(8)-t, gdbSNP:35036378
complement(23..24)-, ccttdbSNP:144533879
complement(167)-c, adbSNP:111572677
complement(233)-t, gdbSNP:113832870
complement(296)-c, adbSNP:147844441
complement(315..316)-, cdbSNP:3832949
complement(394)-dbSNP:
complement(394)-t, cdbSNP:140514427
complement(410)-t, cdbSNP:186173828
complement(475)-t, cdbSNP:111918185
complement(513)-g, adbSNP:146774535
complement(532)-g, adbSNP:76299711
complement(549)-g, adbSNP:145033525
complement(550)-t, cdbSNP:181439439
complement(560..561)-, tadbSNP:139951512
complement(577)-t, cdbSNP:61760170
complement(620)-g, adbSNP:139413505
complement(650)-t, cdbSNP:200128566
complement(704)-g, adbSNP:61760171
complement(738)-c, adbSNP:199868673
complement(745)-g, adbSNP:147382781
complement(746)-t, cdbSNP:142737037
complement(758)-t, cdbSNP:199565279
complement(760)-g, adbSNP:139503857
complement(768)-t, cdbSNP:150887025
complement(803)-g, adbSNP:141516067
complement(823)-t, cdbSNP:148388530
complement(837)-dbSNP:
complement(837)-t, gdbSNP:142771803
complement(852)-g, adbSNP:138182239
complement(862)-g, cdbSNP:145711407
complement(863)-t, cdbSNP:200062531
complement(867)-g, adbSNP:140630557
complement(888)-t, cdbSNP:145757800
complement(900)-t, cdbSNP:150153463
complement(933)-g, adbSNP:200625141
complement(936)-t, adbSNP:1541060
complement(939)-t, cdbSNP:150534198
complement(962)-g, adbSNP:141760704
complement(963)-t, cdbSNP:151012840
complement(1048)-dbSNP:
complement(1048)-t, cdbSNP:145278854
complement(1050)-g, adbSNP:139479509
complement(1098)-t, cdbSNP:2228481
complement(1101)-g, adbSNP:74808355
complement(1129)-dbSNP:
complement(1129)-g, adbSNP:78851986
complement(1143)-t, cdbSNP:113888207
complement(1153)-t, cdbSNP:145387917
complement(1154)-g, adbSNP:199669101
complement(1156)-t, gdbSNP:200629827
complement(1166)-g, cdbSNP:200990124
complement(1216)-t, cdbSNP:201239439
complement(1235)-g, cdbSNP:202146084
complement(1240)-g, adbSNP:143949374
complement(1269)-c, adbSNP:149404315
complement(1276)-g, adbSNP:139838202
complement(1343)-g, adbSNP:146157130
complement(1399)-t, cdbSNP:201349732
complement(1417)-g, adbSNP:138920605
complement(1437)-dbSNP:
complement(1437)-g, adbSNP:145690231
complement(1443)-t, g, cdbSNP:58256696
complement(1452)-g, adbSNP:1256049
complement(1454)-t, cdbSNP:145661652
complement(1458)-g, cdbSNP:141414270
complement(1465)-t, cdbSNP:148326202
complement(1470)-t, cdbSNP:56926155
complement(1471)-g, adbSNP:149090049
complement(1479)-t, cdbSNP:144986202
complement(1488)-t, cdbSNP:146977918
complement(1504)-g, adbSNP:200264592
complement(1560)-dbSNP:
complement(1560)-c, adbSNP:141474553
complement(1569)-t, cdbSNP:147847668
complement(1570)-t, cdbSNP:144249047
complement(1575)-t, cdbSNP:80118085
complement(1610)-g, adbSNP:112017626
complement(1644)-g, cdbSNP:1256054
complement(1645)-t, gdbSNP:139437364
complement(1656)-t, cdbSNP:45624541
complement(1674)-g, cdbSNP:72548752
complement(1677)-t, gdbSNP:79216673
complement(1685)-g, adbSNP:111471356
complement(1691)-t, cdbSNP:78255744
complement(1705)-dbSNP:
complement(1705)-g, cdbSNP:2229618
complement(1715..1716)-, cdbSNP:34624204
complement(1738)-g, adbSNP:142544449
complement(1748)-g, adbSNP:146717881
complement(1763)-c, adbSNP:211694397
complement(1764)-g, adbSNP:148775627
complement(1765)-t, cdbSNP:200615874
complement(1785)-c, adbSNP:113652563
complement(1791)-t, cdbSNP:60101369
complement(1800)-g, adbSNP:144392940
complement(1829)-t, cdbSNP:139785869
complement(1841)-t, adbSNP:146380568
complement(1963)-t, cdbSNP:141940742
complement(1976)-t, cdbSNP:188329310
complement(1991)-g, adbSNP:149353401
complement(1994)-t, cdbSNP:138689384
complement(2013)-t, cdbSNP:201044476
complement(2016)-t, cdbSNP:150646898
complement(2027)-t, cdbSNP:141906585
complement(2033)-t, cdbSNP:199757132
complement(2041)-g, adbSNP:200502775
complement(2052)-t, cdbSNP:112815397
complement(2063)-t, cdbSNP:200747927
complement(2100)-g, adbSNP:4986938
complement(2108)-g, adbSNP:148179737
complement(2118)-t, cdbSNP:111531403
Gene SymbolESR2
Gene SynonymER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Chromosome14
Locus Map14q23.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001040275 Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant b, mRNA. In-stock $509.00 $460.00 12
NM_001214902 Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant d, mRNA. On-demand $699.00 18
NM_001214903 Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant e, mRNA. On-demand $699.00 18
NM_001271876 Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant f, mRNA. On-demand $699.00 18
NM_001271877 Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant g, mRNA. On-demand $699.00 18
NM_001437 Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant a, mRNA. On-demand $699.00 18
Title Common single-nucleotide polymorphisms in the estrogen receptor beta promoter are associated with colorectal cancer survival in postmenopausal women .
Author Passarelli,M.N., Phipps,A.I., Potter,J.D., Makar,K.W., Coghill,A.E., Wernli,K.J., White,E., Chan,A.T., Hutter,C.M., Peters,U. and Newcomb,P.A.
Journal Cancer Res. 73 (2), 767-775 (2013)
Title Clinicopathological significance of the expression of estrogen receptor-beta and vascular endothelial growth factor-A in colorectal cancer .
Author Taggarshe,D., Lobocki,C., Silberberg,B., McKendrick,A. and Mittal,V.K.
Journal Am Surg 78 (12), 1376-1382 (2012)
Title [LOH and genetic polymorphysms of breast cancer] .
Author Utsumi,T.
Journal Nippon Rinsho 70 (SUPPL 7), 71-75 (2012)
Title 3D models of MBP, a biologically active metabolite of bisphenol A, in human estrogen receptor alpha and estrogen receptor beta .
Author Baker,M.E. and Chandsawangbhuwana,C.
Journal PLoS ONE 7 (10), E46078 (2012)
Title Disruption of 3D MCF-12A breast cell cultures by estrogens--an in vitro model for ER-mediated changes indicative of hormonal carcinogenesis .
Author Marchese,S. and Silva,E.
Journal PLoS ONE 7 (10), E45767 (2012)
Title Human estrogen receptor beta binds DNA in a manner similar to and dimerizes with estrogen receptor alpha .
Author Pace,P., Taylor,J., Suntharalingam,S., Coombes,R.C. and Ali,S.
Journal J. Biol. Chem. 272 (41), 25832-25838 (1997)
Title Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300 .
Author Chen,H., Lin,R.J., Schiltz,R.L., Chakravarti,D., Nash,A., Nagy,L., Privalsky,M.L., Nakatani,Y. and Evans,R.M.
Journal Cell 90 (3), 569-580 (1997)
Title ER beta: identification and characterization of a novel human estrogen receptor .
Author Mosselman,S., Polman,J. and Dijkema,R.
Journal FEBS Lett. 392 (1), 49-53 (1996)
Title Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription .
Author Halachmi,S., Marden,E., Martin,G., MacKay,H., Abbondanza,C. and Brown,M.
Journal Science 264 (5164), 1455-1458 (1994)
Title The crystal structure of the estrogen receptor DNA-binding domain bound to DNA: how receptors discriminate between their response elements .
Author Schwabe,J.W., Chapman,L., Finch,J.T. and Rhodes,D.
Journal Cell 75 (3), 567-578 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.