• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant a, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25562 Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant a, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu25562C Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant a, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001437.2, 94538323
Length 1593 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens estrogen receptor 2 (ER beta) (ESR2), transcript variant a, mRNA.
Product estrogen receptor beta isoform 1
Comment

Summary: This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (a, also known as 1) encodes the longest isoform (1).

RefSeq NP_001428.1
CDS 469..2061
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)64
Misc Feature(4)287
Misc Feature(5)318..347
Misc Feature(6)403..405
Misc Feature(7)416..478
Misc Feature(8)469..912
Misc Feature(9)469..912
Misc Feature(10)529..840
Misc Feature(11)727..729
Misc Feature(12)781..783
Misc Feature(13)898..1143
Misc Feature(14)order(913..915,922..924,964..966,973..975,1021..1023,
Misc Feature(15)order(940..951,967..972,976..984,988..993,1060..1065,
Misc Feature(16)order(1018..1029,1039..1044,1057..1059,1066..1068)
Misc Feature(17)1111..2058
Misc Feature(18)1255..1962
Misc Feature(19)order(1360..1362,1375..1377,1381..1383,1483..1485,
Misc Feature(20)order(1396..1398,1408..1410,1447..1452,1462..1464,
Misc Feature(21)order(1675..1677,1687..1689,1693..1698,1756..1758,
Exon (1)1..378
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (2)379..830
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (3)831..1003
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (4)1004..1120
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (5)1121..1420
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (6)1421..1559
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (7)1560..1693
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (8)1694..1874
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Exon (9)1875..2169
Gene:ESR2
Gene Synonym:ER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Translation MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-g, cdbSNP:145304885
complement(8)-t, gdbSNP:35036378
complement(23..24)-, ccttdbSNP:144533879
complement(65)-t, cdbSNP:375468181
complement(167)-c, adbSNP:111572677
complement(233)-t, gdbSNP:113832870
complement(296)-c, adbSNP:147844441
complement(315..316)-, cdbSNP:3832949
complement(394)-dbSNP:
complement(394)-t, cdbSNP:140514427
complement(410)-t, cdbSNP:186173828
complement(420)-t, gdbSNP:374747596
complement(475)-t, cdbSNP:111918185
complement(513)-g, adbSNP:146774535
complement(528)-t, cdbSNP:371185098
complement(532)-g, adbSNP:76299711
complement(549)-g, adbSNP:145033525
complement(550)-t, cdbSNP:181439439
complement(560..561)-, tadbSNP:139951512
complement(577)-t, cdbSNP:61760170
complement(650)-t, cdbSNP:200128566
complement(667)-t, cdbSNP:376782264
complement(673)-g, cdbSNP:373249723
complement(704)-g, adbSNP:61760171
complement(738)-c, adbSNP:199868673
complement(745)-g, adbSNP:147382781
complement(746)-t, cdbSNP:142737037
complement(758)-t, cdbSNP:199565279
complement(760)-g, adbSNP:139503857
complement(768)-t, cdbSNP:150887025
complement(803)-t, g, adbSNP:141516067
complement(823)-t, cdbSNP:148388530
complement(834)-dbSNP:
complement(834)-g, cdbSNP:370669059
complement(837)-t, gdbSNP:142771803
complement(852)-g, adbSNP:138182239
complement(862)-g, cdbSNP:145711407
complement(863)-t, cdbSNP:200062531
complement(867)-g, adbSNP:140630557
complement(888)-t, cdbSNP:145757800
complement(900)-t, cdbSNP:150153463
complement(933)-g, adbSNP:200625141
complement(936)-t, adbSNP:1541060
complement(939)-t, cdbSNP:150534198
complement(945)-g, adbSNP:373386845
complement(962)-g, adbSNP:141760704
complement(963)-t, cdbSNP:151012840
complement(993)-t, cdbSNP:369907593
complement(1043)-dbSNP:
complement(1043)-g, adbSNP:369253565
complement(1047)-g, adbSNP:374870812
complement(1048)-t, cdbSNP:145278854
complement(1050)-g, adbSNP:139479509
complement(1087)-g, adbSNP:371856990
complement(1088)-t, cdbSNP:368924653
1098+c, tdbSNP:2228481
1101+a, gdbSNP:74808355
complement(1129)-dbSNP:
complement(1129)-g, adbSNP:78851986
complement(1143)-t, cdbSNP:113888207
complement(1153)-t, cdbSNP:145387917
complement(1154)-g, adbSNP:199669101
complement(1156)-t, gdbSNP:200629827
complement(1166)-g, cdbSNP:200990124
complement(1173)-g, adbSNP:368036749
complement(1216)-t, cdbSNP:201239439
complement(1223)-g, adbSNP:370979619
complement(1235)-g, cdbSNP:202146084
complement(1240)-g, adbSNP:143949374
complement(1269)-c, adbSNP:149404315
complement(1276)-g, adbSNP:139838202
complement(1399)-t, cdbSNP:201349732
complement(1417)-g, adbSNP:138920605
complement(1437)-dbSNP:
complement(1437)-g, adbSNP:145690231
1443+c, g, tdbSNP:58256696
1452+a, gdbSNP:1256049
complement(1452)-t, cdbSNP:386524925
complement(1454)-t, cdbSNP:145661652
complement(1458)-g, cdbSNP:141414270
1470+c, tdbSNP:56926155
complement(1471)-g, adbSNP:149090049
complement(1479)-t, cdbSNP:144986202
complement(1488)-t, cdbSNP:146977918
complement(1504)-g, adbSNP:200264592
complement(1510)-t, cdbSNP:372274623
complement(1522)-t, cdbSNP:368060197
complement(1560)-dbSNP:
complement(1560)-c, adbSNP:141474553
complement(1569)-t, cdbSNP:147847668
complement(1570)-t, cdbSNP:144249047
1575+c, tdbSNP:80118085
complement(1602)-g, adbSNP:376348920
complement(1608)-g, cdbSNP:374768593
complement(1610)-g, adbSNP:112017626
1644+c, gdbSNP:1256054
complement(1656)-t, cdbSNP:45624541
1674+c, gdbSNP:72548752
1677+g, tdbSNP:79216673
complement(1684)-g, cdbSNP:373170989
complement(1685)-g, adbSNP:111471356
complement(1691)-t, cdbSNP:78255744
1705+dbSNP:
1705+c, gdbSNP:2229618
complement(1714..1715)-, cdbSNP:34624204
complement(1738)-g, adbSNP:142544449
complement(1741)-t, cdbSNP:371686799
complement(1743)-t, cdbSNP:369993150
complement(1748)-g, adbSNP:146717881
complement(1762)-t, cdbSNP:377196538
1763+a, cdbSNP:211694397
complement(1764)-g, adbSNP:148775627
complement(1765)-t, cdbSNP:200615874
complement(1770)-g, adbSNP:368248753
complement(1785)-c, adbSNP:113652563
complement(1786)-c, adbSNP:370716868
1791+c, tdbSNP:60101369
complement(1799)-t, cdbSNP:367855747
complement(1800)-g, adbSNP:144392940
complement(1829)-t, cdbSNP:139785869
complement(1841)-t, adbSNP:146380568
complement(1853)-g, adbSNP:375446581
complement(1872)-t, cdbSNP:370033234
complement(1895)-dbSNP:
complement(1895)-t, adbSNP:374430941
complement(1962)-g, adbSNP:369733925
complement(1963)-t, cdbSNP:141940742
complement(1976)-t, cdbSNP:188329310
complement(1983)-g, adbSNP:375552642
complement(1991)-g, adbSNP:149353401
complement(1994)-t, cdbSNP:138689384
complement(2010)-t, cdbSNP:374713642
complement(2011)-t, cdbSNP:376023274
complement(2013)-t, cdbSNP:201044476
complement(2016)-t, cdbSNP:150646898
complement(2033)-t, cdbSNP:199757132
complement(2041)-g, adbSNP:200502775
complement(2052)-t, cdbSNP:112815397
complement(2063)-t, cdbSNP:200747927
complement(2064)-g, adbSNP:367649109
complement(2069)-g, adbSNP:374618716
2100+a, gdbSNP:4986938
complement(2100)-t, cdbSNP:386597008
complement(2108)-g, adbSNP:148179737
complement(2118)-t, cdbSNP:111531403
Gene SymbolESR2
Gene SynonymER-BETA; Erb; ESR-BETA; ESRB; ESTRB; NR3A2
Chromosome14
Locus Map14q23.2
Title Differential expression of estrogen receptor alpha, beta1, and beta2 in lobular and ductal breast cancer .
Author Huang B, Omoto Y, Iwase H, Yamashita H, Toyama T, Coombes RC, Filipovic A, Warner M and Gustafsson JA.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (5), 1933-1938 (2014)
Title A meta-analysis of oestrogen receptor, progesterone receptor and human epidermal growth factor receptor 2 discordance between primary breast cancer and metastases .
Author Aurilio G, Disalvatore D, Pruneri G, Bagnardi V, Viale G, Curigliano G, Adamoli L, Munzone E, Sciandivasci A, De Vita F, Goldhirsch A and Nole F.
Journal Eur. J. Cancer 50 (2), 277-289 (2014)
Title Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism .
Author Corominas R, Yang X, Lin GN, Kang S, Shen Y, Ghamsari L, Broly M, Rodriguez M, Tam S, Trigg SA, Fan C, Yi S, Tasan M, Lemmens I, Kuang X, Zhao N, Malhotra D, Michaelson JJ, Vacic V, Calderwood MA, Roth FP, Tavernier J, Horvath S, Salehi-Ashtiani K, Korkin D, Sebat J, Hill DE, Hao T, Vidal M and Iakoucheva LM.
Journal Nat Commun 5, 3650 (2014)
Title Differential expression of estrogen receptor beta isoforms in prostate cancer through interplay between transcriptional and translational regulation .
Author Lee MT, Ouyang B, Ho SM and Leung YK.
Journal Mol. Cell. Endocrinol. 376 (1-2), 125-135 (2013)
Title Association of the estrogen receptor-beta gene RsaI and AluI polymorphisms with human idiopathic thin endometrium .
Author Le AW, Wang ZH, Yuan R, Shan LL, Xiao TH, Zhuo R and Shen Y.
Journal Genet. Mol. Res. 12 (4), 5978-5985 (2013)
Title Differential regulation of oestrogen receptor beta isoforms by 5' untranslated regions in cancer .
Author Smith L, Brannan RA, Hanby AM, Shaaban AM, Verghese ET, Peter MB, Pollock S, Satheesha S, Szynkiewicz M, Speirs V and Hughes TA.
Journal J. Cell. Mol. Med. 14 (8), 2172-2184 (2010)
Title Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300 .
Author Chen H, Lin RJ, Schiltz RL, Chakravarti D, Nash A, Nagy L, Privalsky ML, Nakatani Y and Evans RM.
Journal Cell 90 (3), 569-580 (1997)
Title ER beta: identification and characterization of a novel human estrogen receptor .
Author Mosselman S, Polman J and Dijkema R.
Journal FEBS Lett. 392 (1), 49-53 (1996)
Title Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription .
Author Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C and Brown M.
Journal Science 264 (5164), 1455-1458 (1994)
Title The crystal structure of the estrogen receptor DNA-binding domain bound to DNA: how receptors discriminate between their response elements .
Author Schwabe JW, Chapman L, Finch JT and Rhodes D.
Journal Cell 75 (3), 567-578 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.