• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens forkhead box C1 (FOXC1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19618 Homo sapiens forkhead box C1 (FOXC1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19618C Homo sapiens forkhead box C1 (FOXC1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001453.2, 119395715
Length 1662 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens forkhead box C1 (FOXC1), mRNA.
Product forkhead box protein C1
Comment

Summary: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from genomic sequence data because mRNA transcripts were not available for the full length of the gene. The extent of this transcript is supported by orthologous mouse data.

RefSeq NP_001444.2
CDS 1..1662
Misc Feature(1)232..465
Misc Feature(2)232..465
Misc Feature(3)order(340..345,370..372,379..384,442..444)
Misc Feature(4)703..705
Misc Feature(5)721..723
Misc Feature(6)958..960
Misc Feature(7)1561..1563
Exon (1)1..3452
Gene:FOXC1
Gene Synonym:ARA; FKHL7; FREAC-3; FREAC3; IGDA; IHG1; IRID1; RIEG3
Translation MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGM ARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQ GWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAV KDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPL SPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAP PPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSL YSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAG GSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGG DLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLY RTSGAFVYDCSKF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
67+c, tdbSNP:104893952
141+c, tdbSNP:372857241
144+a, gdbSNP:112885689
159+c, tdbSNP:374448293
171+c, gdbSNP:188085399
189+c, tdbSNP:375581157
192+c, tdbSNP:368260972
195+a, gdbSNP:150084174
204+g, tdbSNP:35168188
207+c, g, tdbSNP:35974174
216+a, gdbSNP:200040370
245+c, gdbSNP:104893953
246+c, tdbSNP:376405759
261+c, gdbSNP:104893954
279+c, tdbSNP:141798688
283+c, gdbSNP:369078747
315+c, tdbSNP:201891353
321+c, tdbSNP:201072263
330+c, gdbSNP:146275363
335+c, tdbSNP:104893951
358+c, tdbSNP:121909339
378+c, gdbSNP:104893958
388+c, tdbSNP:121909338
392+c, tdbSNP:104893957
405+c, tdbSNP:2230096
409+c, gdbSNP:9502980
423+c, gdbSNP:142581779
438+c, gdbSNP:144066933
441+c, tdbSNP:376255999
468+a, gdbSNP:200100677
474+c, tdbSNP:369346224
477+c, tdbSNP:200884695
502+c, tdbSNP:148739656
544+a, gdbSNP:142371761
579+g, tdbSNP:376935827
889+c, tdbSNP:79691946
921+c, tdbSNP:369300819
1140..1141+, ggcdbSNP:398123611
1141..1142+, gcgdbSNP:76840944
1267+g, tdbSNP:281865460
1276+a, gdbSNP:1051933
1333+a, cdbSNP:75089353
1338..1339+, cggdbSNP:373075286
1361..1362+, cggdbSNP:398123612
1443+c, tdbSNP:183970787
1453+c, tdbSNP:76166083
1458+a, c, gdbSNP:1051934
1464+a, gdbSNP:373281258
1549+a, gdbSNP:376059255
1554+g, tdbSNP:201687238
1563+g, tdbSNP:73406891
1575+g, tdbSNP:139877144
1599+c, tdbSNP:201266312
1603+c, tdbSNP:201942493
1626+c, gdbSNP:145620663
1650+c, tdbSNP:147749489
1651+a, gdbSNP:140891639
1692+c, gdbSNP:199666960
1697+a, gdbSNP:370151681
1699+c, tdbSNP:374620749
1714+a, gdbSNP:73406893
1767+a, cdbSNP:116336796
1887+a, gdbSNP:374954433
1940+c, tdbSNP:368696215
1971+a, tdbSNP:62390613
2002+c, gdbSNP:181633430
2209+a, gdbSNP:77607008
2238+a, cdbSNP:34877245
2357+c, tdbSNP:373198124
2396+a, tdbSNP:35717904
2507+c, gdbSNP:377765731
2565+g, tdbSNP:35607877
2681+c, gdbSNP:140591342
2701+a, tdbSNP:371193842
2754+a, cdbSNP:190526847
2849+a, tdbSNP:984253
2860+a, gdbSNP:182014366
2890+a, cdbSNP:34470720
2913..2914+, aadbSNP:35347817
2952+a, tdbSNP:186543284
3006+a, gdbSNP:2745599
3015+g, tdbSNP:189813928
3108+a, gdbSNP:181076077
complement(3160)-t, cdbSNP:3799328
3227+a, gdbSNP:185531077
3287+c, gdbSNP:370514174
3293+a, gdbSNP:34380836
3308+g, tdbSNP:369046889
Gene SymbolFOXC1
Gene SynonymARA; FKHL7; FREAC-3; FREAC3; IGDA; IHG1; IRID1; RIEG3
Chromosome6
Locus Map6p25
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001453 Homo sapiens forkhead box C1 (FOXC1), mRNA. On-demand TBD TBD
Title FOXC1 in human trabecular meshwork cells is involved in regulatory pathway that includes miR-204, MEIS2, and ITGbeta1 .
Author Paylakhi SH, Moazzeni H, Yazdani S, Rassouli P, Arefian E, Jaberi E, Arash EH, Gilani AS, Fan JB, April C, Amin S, Suri F and Elahi E.
Journal Exp. Eye Res. 111, 112-121 (2013)
Title A novel forkhead box C1 gene mutation in a Korean family with Axenfeld-Rieger syndrome .
Author Kim GN, Ki CS, Seo SW, Yoo JM, Han YS, Chung IY, Park JM and Kim SJ.
Journal Mol. Vis. 19, 935-943 (2013)
Title Copy number aberrations of genes regulating normal thymus development in thymic epithelial tumors .
Author Petrini I, Wang Y, Zucali PA, Lee HS, Pham T, Voeller D, Meltzer PS and Giaccone G.
Journal Clin. Cancer Res. 19 (8), 1960-1971 (2013)
Title High expression of FOXC1 is associated with poor clinical outcome in non-small cell lung cancer patients .
Author Wei LX, Zhou RS, Xu HF, Wang JY and Yuan MH.
Journal Tumour Biol. 34 (2), 941-946 (2013)
Title High level of FOXC1 expression is associated with poor prognosis in pancreatic ductal adenocarcinoma .
Author Wang L, Gu F, Liu CY, Wang RJ, Li J and Xu JY.
Journal Tumour Biol. 34 (2), 853-858 (2013)
Title Autosomal dominant Axenfeld-Rieger anomaly maps to 6p25 .
Author Gould,D.B., Mears,A.J., Pearce,W.G. and Walter,M.A.
Journal Am. J. Hum. Genet. 61 (3), 765-768 (1997)
Title Autosomal dominant iridogoniodysgenesis anomaly maps to 6p25 .
Author Mears AJ, Mirzayans F, Gould DB, Pearce WG and Walter MA.
Journal Am. J. Hum. Genet. 59 (6), 1321-1327 (1996)
Title Chromosomal localization of six human forkhead genes, freac-1 (FKHL5), -3 (FKHL7), -4 (FKHL8), -5 (FKHL9), -6 (FKHL10), and -8 (FKHL12) .
Author Larsson C, Hellqvist M, Pierrou S, White I, Enerback S and Carlsson P.
Journal Genomics 30 (3), 464-469 (1995)
Title Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending .
Author Pierrou S, Hellqvist M, Samuelsson L, Enerback S and Carlsson P.
Journal EMBO J. 13 (20), 5002-5012 (1994)
Title Drosophila forkhead homologues are expressed in a lineage-restricted manner in human hematopoietic cells .
Author Hromas R, Moore J, Johnston T, Socha C and Klemsz M.
Journal Blood 81 (11), 2854-2859 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.