• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_001458 Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA. ORF Sequence Quote
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001458.4, 188595685
Length 9149 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA.
Product filamin-C isoform a
Comment

Summary: This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (a).

RefSeq NP_001449.3
CDS 210..8387
Misc Feature(1)39..41
Misc Feature(2)39..41
Misc Feature(3)210..1013
Misc Feature(4)210..1013
Misc Feature(5)318..632
Misc Feature(6)order(318..323,327..335,342..344,351..353,519..524,
Misc Feature(7)690..980
Misc Feature(8)order(690..692,696..704,711..713,720..722,873..878,
Misc Feature(9)1017..1313
Misc Feature(10)1029..1304
Misc Feature(11)1032..1322
Misc Feature(12)1317..1613
Misc Feature(13)1326..1601
Misc Feature(14)1332..1622
Misc Feature(15)1614..1904
Misc Feature(16)1620..1895
Misc Feature(17)1629..1910
Misc Feature(18)1905..2183
Misc Feature(19)1920..2174
Misc Feature(20)1923..2192
Misc Feature(21)2193..2483
Misc Feature(22)2202..2474
Misc Feature(23)2208..2492
Misc Feature(24)2484..2792
Misc Feature(25)2493..2783
Misc Feature(26)2499..2801
Misc Feature(27)2793..3089
Misc Feature(28)2805..3080
Misc Feature(29)2808..3098
Misc Feature(30)3090..3377
Misc Feature(31)3096..3365
Misc Feature(32)3108..3389
Misc Feature(33)3378..3656
Misc Feature(34)3384..3647
Misc Feature(35)3393..3662
Misc Feature(36)3657..3941
Misc Feature(37)3663..3926
Misc Feature(38)3672..3950
Misc Feature(39)3690..3692
Misc Feature(40)3942..4241
Misc Feature(41)3948..4232
Misc Feature(42)3960..4250
Misc Feature(43)4242..4520
Misc Feature(44)4251..4511
Misc Feature(45)4257..4511
Misc Feature(46)4521..4808
Misc Feature(47)4551..4817
Misc Feature(48)4551..4799
Misc Feature(49)4809..5099
Misc Feature(50)4821..5090
Misc Feature(51)4824..5108
Misc Feature(52)5109..5402
Misc Feature(53)5115..5405
Misc Feature(54)5409..5507
Misc Feature(55)<5592..5774
Misc Feature(56)<5610..5756
Misc Feature(57)5769..6047
Misc Feature(58)5775..6038
Misc Feature(59)5793..6053
Misc Feature(60)6048..6308
Misc Feature(61)<6129..6299
Misc Feature(62)<6135..6317
Misc Feature(63)6315..6593
Misc Feature(64)6324..6584
Misc Feature(65)6330..6599
Misc Feature(66)6693..6938
Misc Feature(67)6906..6908
Misc Feature(68)<6921..7115
Misc Feature(69)<6939..7133
Misc Feature(70)6939..7127
Misc Feature(71)7134..7412
Misc Feature(72)7149..7415
Misc Feature(73)7149..7403
Misc Feature(74)7428..7688
Misc Feature(75)7431..7703
Misc Feature(76)7713..7976
Misc Feature(77)7722..7994
Misc Feature(78)7986..8099
Misc Feature(79)8103..8372
Misc Feature(80)8112..8381
Misc Feature(81)8256..8258
Exon (1)1..561
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (2)562..810
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (3)811..908
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (4)909..1059
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (5)1060..1178
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (6)1179..1256
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (7)1257..1419
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (8)1420..1620
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (9)1621..1758
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (10)1759..1885
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (11)1886..2022
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (12)2023..2216
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (13)2217..2330
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (14)2331..2474
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (15)2475..2598
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (16)2599..2759
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (17)2760..2850
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (18)2851..3020
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (19)3021..3138
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (20)3139..3401
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (21)3402..3999
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (22)4000..4173
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (23)4174..4336
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (24)4337..4497
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (25)4498..4665
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (26)4666..4789
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (27)4790..4946
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (28)4947..5136
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (29)5137..5160
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (30)5161..5408
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (31)5409..5507
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (32)5508..5607
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (33)5608..5748
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (34)5749..5877
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (35)5878..6051
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (36)6052..6213
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (37)6214..6417
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (38)6418..6570
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (39)6571..6693
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (40)6694..6936
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (41)6937..7206
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (42)7207..7344
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (43)7345..7460
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (44)7461..7593
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (45)7594..7770
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (46)7771..7989
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (47)7990..8199
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (48)8200..9138
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Translation MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR RDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA KLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI PGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKA EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPH EEEPSEVPQLRQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTG EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSR HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLP TAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTAS IRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGD ASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKI PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPA VFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVP QEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTR EAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVP VASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELD SDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTT GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGP QHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVT RGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKE KGDYILIVKWGDESVPGSPFKVKVP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
198+g, tdbSNP:199842696
230+a, cdbSNP:201179596
356+c, tdbSNP:3734972
503+a, gdbSNP:201839252
609+dbSNP:
609+a, gdbSNP:150285287
735+c, tdbSNP:12532312
765+a, cdbSNP:137926567
770+c, tdbSNP:149474376
806+c, tdbSNP:143942649
809+c, tdbSNP:202105410
851+dbSNP:
851+c, tdbSNP:2291558
929+dbSNP:
929+c, tdbSNP:2291560
933+g, tdbSNP:80097455
1002+c, gdbSNP:13237814
1004+c, tdbSNP:2291561
1035+a, cdbSNP:113049908
1073+dbSNP:
1073+a, gdbSNP:201906839
1121+c, tdbSNP:201239973
1127+c, tdbSNP:200471132
1194+dbSNP:
1194+a, gdbSNP:62479628
1235+c, tdbSNP:200633995
1241+c, tdbSNP:2291562
1290+dbSNP:
1290+c, tdbSNP:200206944
1378+a, gdbSNP:188905854
1379+c, tdbSNP:200675882
1513+dbSNP:
1513+c, tdbSNP:199935488
1563+a, gdbSNP:192163925
1583+c, tdbSNP:115140972
1634+dbSNP:
1634+c, tdbSNP:143610360
1643+c, tdbSNP:201810745
1667+a, cdbSNP:2291563
1683+a, gdbSNP:118056738
1722+a, gdbSNP:200935123
1723+c, gdbSNP:185847889
1728+a, gdbSNP:189525930
1777+dbSNP:
1777+c, tdbSNP:182845462
1786+a, gdbSNP:34932223
1809+a, gdbSNP:201905890
1813+a, gdbSNP:62479630
1814+c, tdbSNP:199976790
1815+a, gdbSNP:141616435
1823+c, tdbSNP:76046880
1850+c, gdbSNP:202142168
1866+a, gdbSNP:201572079
1907+dbSNP:
1907+c, tdbSNP:112194548
2060+dbSNP:
2060+a, gdbSNP:199715890
2069+c, tdbSNP:1063260
2111+a, gdbSNP:12536635
2250+dbSNP:
2250+a, gdbSNP:199705417
2277+c, tdbSNP:200943714
2287+a, cdbSNP:34972246
2333+dbSNP:
2333+c, tdbSNP:187481700
2334+a, gdbSNP:192725607
2351+c, tdbSNP:199595235
2389+a, gdbSNP:200618242
2408+c, gdbSNP:200655185
2505+dbSNP:
2505+c, tdbSNP:200215340
2586+a, gdbSNP:187143486
2659+dbSNP:
2659+c, tdbSNP:200653747
2710+c, tdbSNP:75133741
2716+a, cdbSNP:199652368
2764+dbSNP:
2764+c, tdbSNP:111482519
2777+c, tdbSNP:201611050
2805+a, gdbSNP:201006462
2811+a, gdbSNP:201002262
2883+dbSNP:
2883+a, gdbSNP:200986712
2895+a, gdbSNP:200215903
2956+a, gdbSNP:143720860
2999+c, tdbSNP:199966433
3008+c, tdbSNP:202186772
3026+dbSNP:
3026+c, tdbSNP:201006494
3048..3049+, gdbSNP:143970363
3055+a, gdbSNP:200474685
3098+a, gdbSNP:191892345
3209+dbSNP:
3209+c, tdbSNP:184454068
3214+a, gdbSNP:202039743
3215+a, gdbSNP:61737781
3264+g, tdbSNP:200864007
3342+a, cdbSNP:201863231
3393+, cdbSNP:35364070
3451+dbSNP:
3451+c, tdbSNP:200169573
3506+a, gdbSNP:3734973
3513+c, tdbSNP:199707920
3591+a, gdbSNP:145724410
3635+c, tdbSNP:201313781
3640+c, gdbSNP:200723434
3667+g, tdbSNP:138663492
3685+a, gdbSNP:141199483
3711+a, gdbSNP:199814952
3791+a, gdbSNP:200712644
3801+c, gdbSNP:201912847
3830+c, tdbSNP:117864464
3832+c, tdbSNP:202184162
3833+a, gdbSNP:35281128
3930+c, tdbSNP:146953558
3958+c, tdbSNP:200672491
3960..3961+, gdbSNP:34691046
3965+c, tdbSNP:113589230
3966+a, gdbSNP:117366477
3999+a, gdbSNP:201335143
4047+dbSNP:
4047+c, tdbSNP:34180031
4061+c, tdbSNP:111337293
4062+a, gdbSNP:200928780
4147+a, gdbSNP:199804244
4162+c, tdbSNP:181276444
4169+a, gdbSNP:200717144
4175+dbSNP:
4175+c, tdbSNP:200237564
4181+c, tdbSNP:201922688
4182+c, tdbSNP:34373805
4231+a, gdbSNP:149641783
4265+c, tdbSNP:75770585
4269+c, tdbSNP:138193236
4306+a, gdbSNP:185746835
4334+c, tdbSNP:191931963
4343+dbSNP:
4343+a, gdbSNP:200942470
4349+c, tdbSNP:183668401
4362+c, tdbSNP:202125701
4370+c, tdbSNP:200288149
4382+a, gdbSNP:201481324
4510+dbSNP:
4510+a, g, tdbSNP:143623535
4511+c, tdbSNP:114697352
4613+a, gdbSNP:2249128
4640+a, gdbSNP:2291568
4680+dbSNP:
4680+a, gdbSNP:186904046
4683+a, gdbSNP:71581926
4762+a, gdbSNP:201635205
4847+dbSNP:
4847+c, gdbSNP:2739862
4909+a, gdbSNP:2291569
4948+dbSNP:
4948+a, gdbSNP:2643766
4972+c, gdbSNP:148545460
5004+a, gdbSNP:2643767
5156+dbSNP:
5156+c, tdbSNP:201069454
5198+dbSNP:
5198+g, tdbSNP:10269893
5251+c, gdbSNP:193159707
5252+a, gdbSNP:200405579
5264+a, gdbSNP:57797061
5279+c, tdbSNP:202027738
5337+a, gdbSNP:200077114
5352+a, gdbSNP:200178370
5383+c, tdbSNP:76819052
5430+dbSNP:
5430+a, gdbSNP:200792813
5487+a, gdbSNP:150986092
5493+c, tdbSNP:201926772
5513+dbSNP:
5513+a, cdbSNP:202181957
5520+c, gdbSNP:200001272
5583+a, gdbSNP:201348102
5584+c, tdbSNP:200233856
5619+dbSNP:
5619+a, tdbSNP:201949844
5677+c, tdbSNP:140857707
5782+dbSNP:
5782+a, cdbSNP:76165988
5787+c, tdbSNP:181067717
5801+c, tdbSNP:117517372
5853+a, gdbSNP:184018403
5968+dbSNP:
5968+c, tdbSNP:199714090
5972+c, tdbSNP:3816884
5973+a, gdbSNP:202128602
5975+a, gdbSNP:58914363
6022..6023+, gdbSNP:34549586
6143+dbSNP:
6143+c, tdbSNP:182514003
6163+c, tdbSNP:200415625
6275+dbSNP:
6275+c, gdbSNP:201902050
6329+c, tdbSNP:116974302
6365+c, tdbSNP:199750173
6384+a, gdbSNP:201333104
6425+dbSNP:
6425+a, gdbSNP:200670345
6471+c, tdbSNP:201695815
6489+a, gdbSNP:188476936
6596+dbSNP:
6596+c, tdbSNP:200182180
6613+a, gdbSNP:1063261
6668+c, g, tdbSNP:113618587
6756+dbSNP:
6756+c, tdbSNP:201695827
6817+c, gdbSNP:1063262
6923+c, tdbSNP:10268251
6980+dbSNP:
6980+a, gdbSNP:34422412
7017+a, gdbSNP:202223616
7037+c, gdbSNP:1063263
7186+a, gdbSNP:201028676
7199+c, tdbSNP:113579230
7200+a, gdbSNP:191288058
7208+dbSNP:
7208+c, tdbSNP:201735453
7300+a, gdbSNP:201672146
7317+a, gdbSNP:201917318
7394+dbSNP:
7394+c, tdbSNP:199880128
7430+c, tdbSNP:3816885
7465+dbSNP:
7465+c, tdbSNP:199768217
7466+a, gdbSNP:201008333
7490+a, gdbSNP:186451916
7498+c, tdbSNP:200516164
7519+a, gdbSNP:201762568
7632+dbSNP:
7632+a, gdbSNP:191224002
7695+a, gdbSNP:200295337
7813+dbSNP:
7813+c, gdbSNP:201895675
7818+a, gdbSNP:201486752
7823+g, tdbSNP:180834558
7845+a, tdbSNP:200673841
7866+c, tdbSNP:199519281
7886+c, tdbSNP:200760961
8071+dbSNP:
8071+a, gdbSNP:201636548
8164+a, gdbSNP:201420449
8212+dbSNP:
8212+c, tdbSNP:200502811
8228+a, cdbSNP:112180788
8255+a, gdbSNP:199605456
8258+c, tdbSNP:183104951
8313+, gdbSNP:67870051
8327+c, tdbSNP:28379666
8330+c, tdbSNP:28437296
8339+a, gdbSNP:121909518
8388+a, gdbSNP:114713626
8431+a, cdbSNP:28687249
8441..8446+, acacacdbSNP:145777348
8441..8444+, acacdbSNP:71999880
8441..8442+, acdbSNP:113516962
8442+, cadbSNP:60473969
8444+c, tdbSNP:28727967
8446..8451+, cacacadbSNP:72348656
8480..8481+, acacdbSNP:71882848
8484+a, gdbSNP:28609612
8485+c, tdbSNP:144986537
8554+a, gdbSNP:13308050
8559+a, gdbSNP:186844166
8562+g, tdbSNP:190543911
8576+g, tdbSNP:13308085
8601+c, tdbSNP:3800585
8715+a, gdbSNP:71581929
8776+c, tdbSNP:183078755
8864+a, cdbSNP:14405
8889+a, gdbSNP:3188410
8902+c, tdbSNP:1063267
8931+c, tdbSNP:150932895
8934+a, gdbSNP:187750413
9036+a, cdbSNP:1048458
9056+c, tdbSNP:1048459
9104+a, gdbSNP:117394163
9130+a, tdbSNP:112798143
Gene SymbolFLNC
Gene SynonymABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Chromosome7
Locus Map7q32-q35
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001127487 Homo sapiens filamin C, gamma (FLNC), transcript variant 2, mRNA. Full Length Quote
ORF Sequence Quote
NM_001458 Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA. Full Length Quote
ORF Sequence Quote
Title Structural interaction and functional regulation of polycystin-2 by filamin .
Author Wang,Q., Dai,X.Q., Li,Q., Wang,Z., Cantero Mdel,R., Li,S., Shen,J., Tu,J.C., Cantiello,H. and Chen,X.Z.
Journal PLoS ONE 7 (7), E40448 (2012)
Title Distal myopathy with upper limb predominance caused by filamin C haploinsufficiency .
Author Guergueltcheva,V., Peeters,K., Baets,J., Ceuterick-de Groote,C., Martin,J.J., Suls,A., De Vriendt,E., Mihaylova,V., Chamova,T., Almeida-Souza,L., Ydens,E., Tzekov,C., Hadjidekov,G., Gospodinova,M., Storm,K., Reyniers,E., Bichev,S., van der Ven,P.F., Furst,D.O., Mitev,V., Lochmuller,H., Timmerman,V., Tournev,I., De Jonghe,P. and Jordanova,A.
Journal Neurology 77 (24), 2105-2114 (2011)
Title Mutations in the N-terminal actin-binding domain of filamin C cause a distal myopathy .
Author Duff,R.M., Tay,V., Hackman,P., Ravenscroft,G., McLean,C., Kennedy,P., Steinbach,A., Schoffler,W., van der Ven,P.F., Furst,D.O., Song,J., Djinovic-Carugo,K., Penttila,S., Raheem,O., Reardon,K., Malandrini,A., Gambelli,S., Villanova,M., Nowak,K.J., Williams,D.R., Landers,J.E., Brown,R.H. Jr., Udd,B. and Laing,N.G.
Journal Am. J. Hum. Genet. 88 (6), 729-740 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Case-control genome-wide association study of attention-deficit/hyperactivity disorder .
Author Neale,B.M., Medland,S., Ripke,S., Anney,R.J., Asherson,P., Buitelaar,J., Franke,B., Gill,M., Kent,L., Holmans,P., Middleton,F., Thapar,A., Lesch,K.P., Faraone,S.V., Daly,M., Nguyen,T.T., Schafer,H., Steinhausen,H.C., Reif,A., Renner,T.J., Romanos,M., Romanos,J., Warnke,A., Walitza,S., Freitag,C., Meyer,J., Palmason,H., Rothenberger,A., Hawi,Z., Sergeant,J., Roeyers,H., Mick,E. and Biederman,J.
Journal J Am Acad Child Adolesc Psychiatry 49 (9), 906-920 (2010)
Title Cytoskeletal protein ABP-280 directs the intracellular trafficking of furin and modulates proprotein processing in the endocytic pathway .
Author Liu,G., Thomas,L., Warren,R.A., Enns,C.A., Cunningham,C.C., Hartwig,J.H. and Thomas,G.
Journal J. Cell Biol. 139 (7), 1719-1733 (1997)
Title Actin-binding protein-280 binds the stress-activated protein kinase (SAPK) activator SEK-1 and is required for tumor necrosis factor-alpha activation of SAPK in melanoma cells .
Author Marti,A., Luo,Z., Cunningham,C., Ohta,Y., Hartwig,J., Stossel,T.P., Kyriakis,J.M. and Avruch,J.
Journal J. Biol. Chem. 272 (5), 2620-2628 (1997)
Title Identification of 4370 expressed sequence tags from a 3'-end-specific cDNA library of human skeletal muscle by DNA sequencing and filter hybridization .
Author Lanfranchi,G., Muraro,T., Caldara,F., Pacchioni,B., Pallavicini,A., Pandolfo,D., Toppo,S., Trevisan,S., Scarso,S. and Valle,G.
Journal Genome Res. 6 (1), 35-42 (1996)
Title Comparative mapping of the actin-binding protein 280 genes in human and mouse .
Author Gariboldi,M., Maestrini,E., Canzian,F., Manenti,G., De Gregorio,L., Rivella,S., Chatterjee,A., Herman,G.E., Archidiacono,N., Antonacci,R. et al.
Journal Genomics 21 (2), 428-430 (1994)
Title Mapping of two genes encoding isoforms of the actin binding protein ABP-280, a dystrophin like protein, to Xq28 and to chromosome 7 .
Author Maestrini,E., Patrosso,C., Mancini,M., Rivella,S., Rocchi,M., Repetto,M., Villa,A., Frattini,A., Zoppe,M., Vezzoni,P. et al.
Journal Hum. Mol. Genet. 2 (6), 761-766 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878