• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu26582 Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $4749.00 40
OHu26582C Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA. Customized vector On-demand $4749.00 40

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001458.4, 188595685
Length 8178 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA.
Product filamin-C isoform a
Comment

Summary: This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (a).

RefSeq NP_001449.3
CDS 210..8387
Misc Feature(1)39..41
Misc Feature(2)39..41
Misc Feature(3)210..1013
Misc Feature(4)210..1013
Misc Feature(5)318..632
Misc Feature(6)order(318..323,327..335,342..344,351..353,519..524,
Misc Feature(7)690..980
Misc Feature(8)order(690..692,696..704,711..713,720..722,873..878,
Misc Feature(9)1017..1313
Misc Feature(10)1032..1322
Misc Feature(11)1317..1613
Misc Feature(12)1332..1622
Misc Feature(13)1614..1904
Misc Feature(14)1629..1910
Misc Feature(15)1905..2183
Misc Feature(16)1923..2192
Misc Feature(17)2193..2483
Misc Feature(18)2208..2492
Misc Feature(19)2484..2792
Misc Feature(20)2499..2801
Misc Feature(21)2793..3089
Misc Feature(22)2808..3098
Misc Feature(23)3090..3377
Misc Feature(24)3108..3389
Misc Feature(25)3378..3656
Misc Feature(26)3393..3662
Misc Feature(27)3657..3941
Misc Feature(28)3672..3950
Misc Feature(29)3690..3692
Misc Feature(30)3942..4241
Misc Feature(31)3960..4250
Misc Feature(32)4242..4520
Misc Feature(33)4257..4526
Misc Feature(34)4521..4808
Misc Feature(35)4536..4817
Misc Feature(36)4809..5099
Misc Feature(37)4824..5108
Misc Feature(38)5115..5405
Misc Feature(39)5409..5507
Misc Feature(40)<5592..5774
Misc Feature(41)5769..6047
Misc Feature(42)5793..6053
Misc Feature(43)6048..6308
Misc Feature(44)6315..6593
Misc Feature(45)6330..6599
Misc Feature(46)6693..6938
Misc Feature(47)6906..6908
Misc Feature(48)<6939..7133
Misc Feature(49)6939..7127
Misc Feature(50)7134..7412
Misc Feature(51)7149..7415
Misc Feature(52)7428..7688
Misc Feature(53)7722..7994
Misc Feature(54)7986..8099
Misc Feature(55)8112..8381
Misc Feature(56)8256..8258
Exon (1)1..561
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (2)562..810
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (3)811..908
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (4)909..1059
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (5)1060..1178
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (6)1179..1256
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (7)1257..1419
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (8)1420..1620
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (9)1621..1758
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (10)1759..1885
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (11)1886..2022
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (12)2023..2216
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (13)2217..2330
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (14)2331..2474
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (15)2475..2598
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (16)2599..2759
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (17)2760..2850
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (18)2851..3020
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (19)3021..3138
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (20)3139..3401
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (21)3402..3999
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (22)4000..4173
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (23)4174..4336
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (24)4337..4497
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (25)4498..4665
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (26)4666..4789
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (27)4790..4946
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (28)4947..5136
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (29)5137..5160
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (30)5161..5408
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (31)5409..5507
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (32)5508..5607
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (33)5608..5748
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (34)5749..5877
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (35)5878..6051
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (36)6052..6213
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (37)6214..6417
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (38)6418..6570
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (39)6571..6693
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (40)6694..6936
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (41)6937..7206
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (42)7207..7344
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (43)7345..7460
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (44)7461..7593
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (45)7594..7770
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (46)7771..7989
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (47)7990..8199
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Exon (48)8200..9138
Gene:FLNC
Gene Synonym:ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Translation MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR RDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA KLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI PGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKA EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPH EEEPSEVPQLRQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTG EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSR HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLP TAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTAS IRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGD ASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKI PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPA VFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVP QEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTR EAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVP VASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELD SDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTT GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGP QHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVT RGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKE KGDYILIVKWGDESVPGSPFKVKVP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
83..84+, gadbSNP:375744248
159+a, cdbSNP:373643982
174+g, tdbSNP:376490644
181+c, tdbSNP:370943622
198+g, tdbSNP:199842696
202+g, tdbSNP:368218457
230+a, cdbSNP:201179596
240+a, gdbSNP:370512642
273+c, tdbSNP:368812043
293+a, gdbSNP:372154508
305+a, gdbSNP:368239688
356+c, tdbSNP:3734972
503+a, gdbSNP:201839252
551+c, tdbSNP:368032737
575+dbSNP:
575+c, tdbSNP:369120591
609+a, gdbSNP:150285287
617+a, gdbSNP:370110008
644+a, gdbSNP:374372530
689+a, gdbSNP:369534561
726+g, tdbSNP:376235207
735+c, tdbSNP:12532312
756+c, tdbSNP:369221655
765+a, cdbSNP:137926567
770+c, tdbSNP:149474376
786+a, gdbSNP:387906587
803+c, tdbSNP:375617228
806+c, tdbSNP:143942649
809+c, tdbSNP:202105410
821+dbSNP:
821+c, tdbSNP:368103032
851+c, tdbSNP:2291558
860+c, tdbSNP:370425863
929+dbSNP:
929+c, tdbSNP:2291560
929+c, tdbSNP:386563926
933+g, tdbSNP:80097455
956+c, tdbSNP:377172731
961+c, tdbSNP:387906586
991+a, gdbSNP:370330345
1002+c, gdbSNP:13237814
1004+c, tdbSNP:2291561
1035+a, cdbSNP:113049908
1073+dbSNP:
1073+a, gdbSNP:201906839
1121+c, tdbSNP:201239973
1127+c, tdbSNP:200471132
1194+dbSNP:
1194+a, gdbSNP:62479628
1209+c, tdbSNP:372497581
1229+c, tdbSNP:376514318
1235+c, tdbSNP:200633995
1241+c, tdbSNP:2291562
1262+dbSNP:
1262+c, tdbSNP:375071103
1290+c, tdbSNP:200206944
1317+a, gdbSNP:370406338
1378+a, gdbSNP:188905854
1379+c, tdbSNP:200675882
1414+c, tdbSNP:374757755
1434+dbSNP:
1434+a, gdbSNP:371913931
1436+c, tdbSNP:375033262
1452+a, gdbSNP:369182765
1468+a, gdbSNP:371410741
1513+c, tdbSNP:199935488
1518+c, tdbSNP:374847180
1519+a, gdbSNP:370138936
1563+a, gdbSNP:192163925
1574+a, gdbSNP:377345122
1581+c, tdbSNP:369747694
1583+c, tdbSNP:115140972
1591+a, gdbSNP:377587489
1634+dbSNP:
1634+c, tdbSNP:143610360
1643+c, tdbSNP:201810745
1667+a, cdbSNP:2291563
1683+a, gdbSNP:118056738
1722+a, gdbSNP:200935123
1723+c, gdbSNP:185847889
1727+c, tdbSNP:368101036
1728+a, gdbSNP:189525930
1750+a, cdbSNP:375881193
1777+dbSNP:
1777+c, tdbSNP:182845462
1786+a, gdbSNP:34932223
1790+a, gdbSNP:267601277
1809+a, gdbSNP:201905890
1813+a, gdbSNP:62479630
1814+c, tdbSNP:199976790
1815+a, gdbSNP:141616435
1823+c, tdbSNP:76046880
1825+c, tdbSNP:375570393
1826+a, gdbSNP:369222964
1850+c, gdbSNP:202142168
1866+a, gdbSNP:201572079
1871+c, tdbSNP:376975967
1881+c, gdbSNP:370326975
1907+dbSNP:
1907+c, tdbSNP:112194548
1911+a, gdbSNP:368225111
1937+c, gdbSNP:370464621
1966+c, tdbSNP:374132023
1979+c, tdbSNP:367987438
2060+dbSNP:
2060+a, gdbSNP:199715890
2069+c, tdbSNP:1063260
2087+c, tdbSNP:369735636
2111+a, gdbSNP:12536635
2132+c, tdbSNP:375361259
2133+a, gdbSNP:369387744
2145+a, gdbSNP:372668691
2156+c, tdbSNP:375623136
2249+dbSNP:
2249+c, tdbSNP:368121231
2250+a, gdbSNP:199705417
2277+c, tdbSNP:200943714
2287+a, cdbSNP:34972246
2292+c, tdbSNP:377314946
2323+a, cdbSNP:368473600
2333+dbSNP:
2333+c, tdbSNP:187481700
2334+a, gdbSNP:192725607
2337+a, gdbSNP:370035829
2349+a, gdbSNP:373212534
2351+c, tdbSNP:199595235
2372+c, tdbSNP:370539335
2376+a, gdbSNP:375414341
2378+c, tdbSNP:377553322
2389+a, gdbSNP:200618242
2408+c, gdbSNP:200655185
2481+dbSNP:
2481+a, gdbSNP:371418145
2490+a, gdbSNP:374691339
2501+c, tdbSNP:369916201
2502+a, gdbSNP:373798394
2505+c, tdbSNP:200215340
2506+a, gdbSNP:369935650
2519+c, tdbSNP:374087953
2525+c, tdbSNP:377595203
2586+a, gdbSNP:187143486
2600+dbSNP:
2600+a, cdbSNP:374768092
2612+a, c, tdbSNP:369234137
2613+a, gdbSNP:371398126
2624+c, tdbSNP:376800693
2659+c, tdbSNP:200653747
2702+a, cdbSNP:374188734
2710+c, tdbSNP:75133741
2716+a, cdbSNP:199652368
2727+c, tdbSNP:373514748
2728+a, gdbSNP:376472014
2737+c, tdbSNP:370556972
2764+dbSNP:
2764+c, tdbSNP:111482519
2766+c, tdbSNP:374302753
2777+c, tdbSNP:201611050
2805+a, gdbSNP:201006462
2811+a, gdbSNP:201002262
2844+c, tdbSNP:374983276
2845+a, gdbSNP:367997079
2851+dbSNP:
2851+g, tdbSNP:377095070
2861+c, tdbSNP:369714355
2883+a, gdbSNP:200986712
2895+a, gdbSNP:200215903
2942+a, gdbSNP:374135903
2956+a, gdbSNP:143720860
2999+c, tdbSNP:199966433
3008+c, tdbSNP:202186772
3026+dbSNP:
3026+c, tdbSNP:201006494
3048+c, gdbSNP:372741923
3050..3051+, g, ggdbSNP:143970363
3052+a, gdbSNP:373298499
3055+a, gdbSNP:200474685
3098+a, gdbSNP:191892345
3116+a, cdbSNP:368059457
3209+dbSNP:
3209+c, tdbSNP:184454068
3214+a, gdbSNP:202039743
3215+a, gdbSNP:61737781
3235+a, gdbSNP:375445167
3254+a, gdbSNP:369511914
3264+g, tdbSNP:200864007
3276+c, gdbSNP:376107866
3294+a, gdbSNP:369078760
3301+a, cdbSNP:372467579
3323+a, gdbSNP:376516180
3342+a, cdbSNP:201863231
3347+a, gdbSNP:369739262
3362+a, gdbSNP:373694043
3393+, cdbSNP:35364070
3418+dbSNP:
3418+c, tdbSNP:370391049
3419+a, gdbSNP:374788113
3451+c, tdbSNP:200169573
3465+a, gdbSNP:369398096
3469+c, gdbSNP:372205719
3506+a, gdbSNP:3734973
3510+g, tdbSNP:368492686
3513+c, tdbSNP:199707920
3580+c, tdbSNP:375013141
3591+a, gdbSNP:145724410
3630+c, tdbSNP:369188936
3635+c, tdbSNP:201313781
3640+c, gdbSNP:200723434
3658+a, gdbSNP:371372377
3667+g, tdbSNP:138663492
3674+c, gdbSNP:374686347
3685+a, gdbSNP:141199483
3697+c, tdbSNP:377489161
3698+c, gdbSNP:369853278
3711+a, gdbSNP:199814952
3761+c, tdbSNP:373310802
3791+a, gdbSNP:200712644
3797+c, tdbSNP:376078628
3801+c, gdbSNP:201912847
3815+a, gdbSNP:374499671
3830+c, tdbSNP:117864464
3832+c, tdbSNP:202184162
3833+a, gdbSNP:35281128
3872+c, tdbSNP:369734958
3889+c, tdbSNP:373573447
3930+c, tdbSNP:146953558
3931+a, gdbSNP:370520806
3953+c, tdbSNP:374922440
3958+c, tdbSNP:200672491
3960..3961+, gdbSNP:34691046
3965+c, tdbSNP:113589230
3966+a, gdbSNP:117366477
3981+c, tdbSNP:374764212
3999+a, gdbSNP:201335143
4002+dbSNP:
4002+a, gdbSNP:368102638
4008+c, tdbSNP:371483562
4047+c, tdbSNP:34180031
4056+a, gdbSNP:367860958
4061+c, tdbSNP:111337293
4062+a, gdbSNP:200928780
4070+c, tdbSNP:375986462
4081+a, gdbSNP:370042010
4097+a, gdbSNP:374182158
4120+c, tdbSNP:377011299
4130+c, tdbSNP:369198655
4147+a, gdbSNP:199804244
4158+a, gdbSNP:377555574
4162+c, tdbSNP:181276444
4169+a, gdbSNP:200717144
4175+dbSNP:
4175+c, tdbSNP:200237564
4181+c, tdbSNP:201922688
4182+c, tdbSNP:34373805
4196+a, gdbSNP:374299121
4212+a, gdbSNP:368220468
4231+a, gdbSNP:149641783
4239+a, gdbSNP:374127804
4263+c, tdbSNP:367931139
4265+c, tdbSNP:75770585
4269+c, g, tdbSNP:138193236
4306+a, gdbSNP:185746835
4334+c, tdbSNP:191931963
4343+dbSNP:
4343+a, gdbSNP:200942470
4349+c, tdbSNP:183668401
4362+c, tdbSNP:202125701
4370+c, tdbSNP:200288149
4382+a, gdbSNP:201481324
4428+a, gdbSNP:375366821
4439+c, tdbSNP:369357718
4480+g, tdbSNP:372668981
4502+dbSNP:
4502+c, tdbSNP:376429779
4505+a, gdbSNP:370827536
4510+a, g, tdbSNP:143623535
4511+c, tdbSNP:114697352
4512+a, gdbSNP:370643162
4515+c, gdbSNP:373694464
4540+c, gdbSNP:367560131
4543+a, gdbSNP:371591881
4546+c, tdbSNP:374219293
4587+c, tdbSNP:376265227
complement(4613)-g, adbSNP:2249128
4629+c, tdbSNP:372454458
4630+a, gdbSNP:376380652
4633+c, tdbSNP:369305865
4634+a, gdbSNP:371971762
4640+a, gdbSNP:2291568
4680+dbSNP:
4680+a, gdbSNP:186904046
4683+a, gdbSNP:71581926
4694+c, tdbSNP:373198674
4697+c, tdbSNP:377258966
4721+c, tdbSNP:370528183
4757+c, tdbSNP:376441465
4762+a, gdbSNP:201635205
4786+a, gdbSNP:374729872
4802+dbSNP:
4802+c, gdbSNP:371988433
4820+c, tdbSNP:376222096
4837+a, gdbSNP:369178040
4844+c, tdbSNP:371367894
4847+c, gdbSNP:2739862
4871+c, tdbSNP:374683306
4908+c, tdbSNP:369842920
4909+a, gdbSNP:2291569
4931+c, tdbSNP:376933198
4948+dbSNP:
4948+a, gdbSNP:2643766
4972+c, gdbSNP:148545460
5000+g, tdbSNP:374180766
5004+a, gdbSNP:2643767
5011+c, tdbSNP:368097380
5012+c, tdbSNP:371475710
5034+c, tdbSNP:374756527
5061+a, gdbSNP:367824027
5123+a, gdbSNP:371385321
5156+dbSNP:
5156+c, tdbSNP:201069454
5179+dbSNP:
5179+a, gdbSNP:374294752
5198+g, tdbSNP:10269893
5204+a, gdbSNP:368212293
5210+a, gdbSNP:370711488
5229+a, gdbSNP:374124083
5251+c, gdbSNP:193159707
5252+a, gdbSNP:200405579
5261+a, gdbSNP:368028177
5264+a, gdbSNP:57797061
5279+c, tdbSNP:202027738
5337+a, gdbSNP:200077114
5352+a, gdbSNP:200178370
complement(5383)-t, cdbSNP:76819052
5403+a, gdbSNP:374848954
5429+dbSNP:
5429+c, tdbSNP:369739871
5430+a, gdbSNP:200792813
5471+c, tdbSNP:369165766
5472+a, gdbSNP:368768007
5481+c, tdbSNP:369187211
5487+a, gdbSNP:150986092
5490+a, gdbSNP:376023896
5493+c, tdbSNP:201926772
5513+dbSNP:
5513+a, cdbSNP:202181957
5520+c, gdbSNP:200001272
5529+c, tdbSNP:370823820
5568+c, gdbSNP:374189615
5576+c, tdbSNP:377214486
5582+c, tdbSNP:370373860
5583+a, gdbSNP:201348102
5584+a, c, tdbSNP:200233856
5597+c, gdbSNP:371633189
5616+dbSNP:
5616+a, cdbSNP:369457426
5619+a, tdbSNP:201949844
5627+a, gdbSNP:376078394
5629+a, gdbSNP:267601278
5635+c, tdbSNP:369118592
5640+c, tdbSNP:374794518
5641+a, gdbSNP:369759751
5658+a, tdbSNP:373146637
5666+c, tdbSNP:376660713
5677+c, tdbSNP:140857707
5687+c, tdbSNP:371167779
5700+a, gdbSNP:374126692
5709+c, tdbSNP:377141822
5782+dbSNP:
5782+a, cdbSNP:76165988
5787+c, tdbSNP:181067717
5801+c, tdbSNP:117517372
5853+a, gdbSNP:184018403
5854+c, tdbSNP:368478867
5879+dbSNP:
5879+a, gdbSNP:369881758
5954+c, tdbSNP:369449907
5968+c, tdbSNP:199714090
5969+a, gdbSNP:375912712
5972+c, tdbSNP:3816884
5973+a, gdbSNP:202128602
5974+c, tdbSNP:377206490
5975+a, gdbSNP:58914363
5986+a, gdbSNP:376653815
5988+a, gdbSNP:369518785
5996+c, tdbSNP:377063332
5997+a, gdbSNP:370076553
6002+c, tdbSNP:374631384
6022..6023+, gdbSNP:34549586
6037+c, tdbSNP:376413798
6098+dbSNP:
6098+a, gdbSNP:374743518
6122+a, gdbSNP:368751662
6131+g, tdbSNP:370900824
6143+c, tdbSNP:182514003
6154+a, gdbSNP:375046429
6163+c, tdbSNP:200415625
6193+a, gdbSNP:371508414
6239+dbSNP:
6239+c, tdbSNP:375957769
6257+c, tdbSNP:369991887
6275+c, gdbSNP:201902050
6308+a, gdbSNP:373208308
6329+c, tdbSNP:116974302
6365+c, tdbSNP:199750173
6384+a, gdbSNP:201333104
6414+a, gdbSNP:368562957
6425+dbSNP:
6425+a, gdbSNP:200670345
6471+c, tdbSNP:201695815
6488+c, tdbSNP:370386782
6489+a, gdbSNP:188476936
6492+a, gdbSNP:373022507
6518+c, tdbSNP:376992044
6525+a, gdbSNP:371373898
6536+c, tdbSNP:374308274
6563+c, tdbSNP:368455239
6583+dbSNP:
6583+c, gdbSNP:371455516
6596+c, tdbSNP:200182180
6597+a, gdbSNP:375778608
6613+a, gdbSNP:1063261
6628+a, gdbSNP:368662317
6668+c, g, tdbSNP:113618587
6713+dbSNP:
6713+a, gdbSNP:372665009
6735+c, tdbSNP:376885778
6756+c, tdbSNP:201695827
6804+a, gdbSNP:368977589
6817+c, gdbSNP:1063262
6818+a, cdbSNP:374101315
6831+a, gdbSNP:376397821
6839+c, tdbSNP:376657814
6868+c, tdbSNP:370839908
6897+c, tdbSNP:374186437
6898+a, gdbSNP:376035195
6911+c, gdbSNP:370589662
6923+c, tdbSNP:10268251
6924+c, tdbSNP:367820987
6929+a, gdbSNP:371391208
6980+dbSNP:
6980+a, gdbSNP:34422412
7017+a, gdbSNP:202223616
7025+c, tdbSNP:375139827
7026+a, gdbSNP:372251350
7037+c, gdbSNP:1063263
7097+c, tdbSNP:375259002
7132+c, tdbSNP:369250297
7186+a, gdbSNP:201028676
7199+c, tdbSNP:113579230
7200+a, gdbSNP:191288058
7208+dbSNP:
7208+c, tdbSNP:201735453
7281+a, gdbSNP:370769744
7299+c, tdbSNP:374973240
7300+a, gdbSNP:201672146
7317+a, gdbSNP:201917318
7331+c, tdbSNP:374711133
7364+dbSNP:
7364+c, gdbSNP:370808172
7394+c, tdbSNP:199880128
7430+c, tdbSNP:3816885
7431+a, gdbSNP:376257910
7465+dbSNP:
7465+c, tdbSNP:199768217
7466+a, gdbSNP:201008333
7490+a, gdbSNP:186451916
7498+c, tdbSNP:200516164
7499+c, tdbSNP:373240622
7519+a, gdbSNP:201762568
7527+a, tdbSNP:377464792
7537+a, gdbSNP:370293647
7539+a, gdbSNP:267601279
7553+a, gdbSNP:376251952
7562+a, gdbSNP:368607789
7572+c, tdbSNP:371262238
7632+dbSNP:
7632+a, gdbSNP:191224002
7691+c, tdbSNP:267601280
7692+c, gdbSNP:374925943
7695+a, gdbSNP:200295337
7700+a, gdbSNP:367843476
7708+a, gdbSNP:371244800
7742+c, tdbSNP:376806697
7754+c, tdbSNP:369791058
7755+a, gdbSNP:373691962
7785+dbSNP:
7785+a, tdbSNP:373973635
7805+c, tdbSNP:377522797
7806+c, gdbSNP:370419207
7809+g, tdbSNP:372504725
7813+c, gdbSNP:201895675
7818+a, gdbSNP:201486752
7823+g, tdbSNP:180834558
7845+a, tdbSNP:200673841
7866+c, tdbSNP:199519281
7867+a, gdbSNP:375213102
7886+c, tdbSNP:200760961
7919+c, tdbSNP:370733196
7940+c, tdbSNP:374072349
8071+dbSNP:
8071+a, gdbSNP:201636548
8084+c, tdbSNP:373614270
8156+c, tdbSNP:368849358
8157+a, gdbSNP:372172779
8164+a, gdbSNP:201420449
8212+dbSNP:
8212+c, tdbSNP:200502811
8222+c, tdbSNP:369678123
8228+a, cdbSNP:112180788
8229+a, gdbSNP:372338218
8255+a, gdbSNP:199605456
8258+c, tdbSNP:183104951
8268+a, gdbSNP:369110441
8279+g, tdbSNP:373087529
8288+c, tdbSNP:376051052
8300+c, tdbSNP:369131204
8327+c, tdbSNP:28379666
8330+c, tdbSNP:28437296
8339+a, gdbSNP:121909518
8352+a, gdbSNP:370832402
8384+g, tdbSNP:374175186
8388+a, gdbSNP:114713626
8431+a, c, tdbSNP:28687249
8440..8441+, acdbSNP:376321904
8441..8446+, acacacdbSNP:145777348
8441..8442+, acdbSNP:113516962
8444+c, tdbSNP:28727967
8462..8463+, cadbSNP:60473969
8484+a, gdbSNP:28609612
8485+c, tdbSNP:144986537
8554+a, gdbSNP:13308050
8559+a, gdbSNP:186844166
8562+g, tdbSNP:190543911
8566+a, gdbSNP:370176726
8576+g, tdbSNP:13308085
8601+c, tdbSNP:3800585
8669+c, tdbSNP:367991983
8715+a, gdbSNP:71581929
8776+c, tdbSNP:183078755
8864+a, cdbSNP:14405
8889+a, gdbSNP:3188410
8902+c, tdbSNP:1063267
8931+c, tdbSNP:150932895
8934+a, gdbSNP:187750413
9036+a, cdbSNP:1048458
9056+c, tdbSNP:1048459
9104+a, gdbSNP:117394163
9130+a, tdbSNP:112798143
Gene SymbolFLNC
Gene SynonymABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Chromosome7
Locus Map7q32-q35
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001458 Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA. On-demand $4749.00 40
NM_001458 Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA. On-demand $4749.00 40
NM_001458 Homo sapiens filamin C, gamma (FLNC), transcript variant 1, mRNA. On-demand $4749.00 40
Title Cyclic AMP-Rap1A signaling mediates cell surface translocation of microvascular smooth muscle alpha2C-adrenoceptors through the actin-binding protein filamin-2 .
Author Motawea HK, Jeyaraj SC, Eid AH, Mitra S, Unger NT, Ahmed AA, Flavahan NA and Chotani MA.
Journal Am. J. Physiol., Cell Physiol. 305 (8), C829-C845 (2013)
Title Altered mucosal DNA methylation in parallel with highly active Helicobacter pylori-related gastritis .
Author Yoshida T, Kato J, Maekita T, Yamashita S, Enomoto S, Ando T, Niwa T, Deguchi H, Ueda K, Inoue I, Iguchi M, Tamai H, Ushijima T and Ichinose M.
Journal Gastric Cancer 16 (4), 488-497 (2013)
Title Impairment of protein degradation in myofibrillar myopathy caused by FLNC/filamin C mutations .
Author Kley RA, van der Ven PF, Olive M, Hohfeld J, Goldfarb LG, Furst DO and Vorgerd M.
Journal Autophagy 9 (3), 422-423 (2013)
Title Structural interaction and functional regulation of polycystin-2 by filamin .
Author Wang Q, Dai XQ, Li Q, Wang Z, Cantero Mdel R, Li S, Shen J, Tu JC, Cantiello H and Chen XZ.
Journal PLoS ONE 7 (7), E40448 (2012)
Title Distal myopathy with upper limb predominance caused by filamin C haploinsufficiency .
Author Guergueltcheva V, Peeters K, Baets J, Ceuterick-de Groote C, Martin JJ, Suls A, De Vriendt E, Mihaylova V, Chamova T, Almeida-Souza L, Ydens E, Tzekov C, Hadjidekov G, Gospodinova M, Storm K, Reyniers E, Bichev S, van der Ven PF, Furst DO, Mitev V, Lochmuller H, Timmerman V, Tournev I, De Jonghe P and Jordanova A.
Journal Neurology 77 (24), 2105-2114 (2011)
Title Actin-binding protein-280 binds the stress-activated protein kinase (SAPK) activator SEK-1 and is required for tumor necrosis factor-alpha activation of SAPK in melanoma cells .
Author Marti A, Luo Z, Cunningham C, Ohta Y, Hartwig J, Stossel TP, Kyriakis JM and Avruch J.
Journal J. Biol. Chem. 272 (5), 2620-2628 (1997)
Title Identification of 4370 expressed sequence tags from a 3'-end-specific cDNA library of human skeletal muscle by DNA sequencing and filter hybridization .
Author Lanfranchi,G., Muraro,T., Caldara,F., Pacchioni,B., Pallavicini,A., Pandolfo,D., Toppo,S., Trevisan,S., Scarso,S. and Valle,G.
Journal Genome Res. 6 (1), 35-42 (1996)
Title Comparative mapping of the actin-binding protein 280 genes in human and mouse .
Author Gariboldi M, Maestrini E, Canzian F, Manenti G, De Gregorio L, Rivella S, Chatterjee A, Herman GE, Archidiacono N and Antonacci R.
Journal Genomics 21 (2), 428-430 (1994)
Title Mapping of two genes encoding isoforms of the actin binding protein ABP-280, a dystrophin like protein, to Xq28 and to chromosome 7 .
Author Maestrini E, Patrosso C, Mancini M, Rivella S, Rocchi M, Repetto M, Villa A, Frattini A, Zoppe M and Vezzoni P.
Journal Hum. Mol. Genet. 2 (6), 761-766 (1993)
Title Myofibrillar Myopathy .
Author Selcen,D. and Engel,A.G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.