• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens gastrulation brain homeobox 2 (GBX2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001485 Homo sapiens gastrulation brain homeobox 2 (GBX2), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_001485.2, 45593143
Length 1335 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens gastrulation brain homeobox 2 (GBX2), mRNA.
Product homeobox protein GBX-2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF118452.1 and BF115559.1. On Mar 19, 2004 this sequence version replaced gi:4503940.

RefSeq NP_001476.2
CDS 39..1085
Misc Feature(1)780..956
Misc Feature(2)780..956
Misc Feature(3)order(780..794,798..800,849..851,867..869,906..908,
Misc Feature(4)order(786..788,795..797,915..917,924..929,936..938)
Exon (1)562..1335
Gene:GBX2
Gene Synonym:GBX2
Translation MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE AAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRG QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGS TTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA KWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(25)-dbSNP:
complement(25)-c, adbSNP:374736896
complement(35)-c, adbSNP:372311841
complement(174)-t, cdbSNP:368609531
complement(243)-c, adbSNP:200404399
complement(344)-g, adbSNP:372002483
complement(367)-c, adbSNP:368198659
complement(398)-g, cdbSNP:79285591
complement(437)-g, cdbSNP:200332557
complement(442)-c, adbSNP:201041634
complement(444)-g, cdbSNP:183456996
complement(460)-t, gdbSNP:149869981
complement(550)-t, cdbSNP:377437929
complement(557)-g, cdbSNP:112186240
complement(563)-dbSNP:
complement(563)-t, gdbSNP:368955018
complement(611)-g, adbSNP:113549935
complement(636)-g, adbSNP:148159384
complement(659)-g, adbSNP:376350133
complement(703)-t, gdbSNP:143663937
complement(723)-t, cdbSNP:202152349
complement(739)-g, cdbSNP:373486610
complement(743)-t, gdbSNP:113681406
complement(747)-t, cdbSNP:201674356
complement(752)-t, cdbSNP:376571505
complement(769)-g, adbSNP:200791522
complement(770)-g, cdbSNP:201407896
complement(785)-t, cdbSNP:372760556
complement(815)-t, cdbSNP:7588069
complement(857)-g, cdbSNP:371662608
complement(899)-g, adbSNP:369589992
complement(929)-g, adbSNP:201868370
complement(938)-g, adbSNP:199751219
complement(1000)-t, gdbSNP:374921067
complement(1007)-g, adbSNP:114693893
complement(1011)-t, cdbSNP:61743573
complement(1078)-t, cdbSNP:371453117
complement(1105)-g, adbSNP:149479396
complement(1109)-t, cdbSNP:370221571
complement(1129)-g, adbSNP:200772923
complement(1130)-g, adbSNP:376885749
complement(1155)-g, adbSNP:116291098
complement(1247)-, gdbSNP:368749436
complement(1327)-t, cdbSNP:368001313
Gene SymbolGBX2
Gene SynonymGBX2
Chromosome2
Locus Map2q37.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001485 Homo sapiens gastrulation brain homeobox 2 (GBX2), mRNA. On-demand TBD TBD
XM_005246071 PREDICTED: Homo sapiens gastrulation brain homeobox 2 (GBX2), transcript variant X1, mRNA. On-demand TBD TBD
Title GWAS of 126,559 individuals identifies genetic variants associated with educational attainment .
Author Rietveld CA, Medland SE, Derringer J, Yang J, Esko T, Martin NW, Westra HJ, Shakhbazov K, Abdellaoui A, Agrawal A, Albrecht E, Alizadeh BZ, Amin N, Barnard J, Baumeister SE, Benke KS, Bielak LF, Boatman JA, Boyle PA, Davies G, de Leeuw C, Eklund N, Evans DS, Ferhmann R, Fischer K, Gieger C, Gjessing HK, Hagg S, Harris JR, Hayward C, Holzapfel C, Ibrahim-Verbaas CA, Ingelsson E, Jacobsson B, Joshi PK, Jugessur A, Kaakinen M, Kanoni S, Karjalainen J, Kolcic I, Kristiansson K, Kutalik Z, Lahti J, Lee SH, Lin P, Lind PA, Liu Y, Lohman K, Loitfelder M, McMahon G, Vidal PM, Meirelles O, Milani L, Myhre R, Nuotio ML, Oldmeadow CJ, Petrovic KE, Peyrot WJ, Polasek O, Quaye L, Reinmaa E, Rice JP, Rizzi TS, Schmidt H, Schmidt R, Smith AV, Smith JA, Tanaka T, Terracciano A, van der Loos MJ, Vitart V, Volzke H, Wellmann J, Yu L, Zhao W, Allik J, Attia JR, Bandinelli S, Bastardot F, Beauchamp J, Bennett DA, Berger K, Bierut LJ, Boomsma DI, Bultmann U, Campbell H, Chabris CF, Cherkas L, Chung MK, Cucca F, de Andrade M, De Jager PL, De Neve JE, Deary IJ, Dedoussis GV, Deloukas P, Dimitriou M, Eiriksdottir G, Elderson MF, Eriksson JG, Evans DM, Faul JD, Ferrucci L, Garcia ME, Gronberg H, Guethnason V, Hall P, Harris JM, Harris TB, Hastie ND, Heath AC, Hernandez DG, Hoffmann W, Hofman A, Holle R, Holliday EG, Hottenga JJ, Iacono WG, Illig T, Jarvelin MR, Kahonen M, Kaprio J, Kirkpatrick RM, Kowgier M, Latvala A, Launer LJ, Lawlor DA, Lehtimaki T, Li J, Lichtenstein P, Lichtner P, Liewald DC, Madden PA, Magnusson PK, Makinen TE, Masala M, McGue M, Metspalu A, Mielck A, Miller MB, Montgomery GW, Mukherjee S, Nyholt DR, Oostra BA, Palmer LJ, Palotie A, Penninx BW, Perola M, Peyser PA, Preisig M, Raikkonen K, Raitakari OT, Realo A, Ring SM, Ripatti S, Rivadeneira F, Rudan I, Rustichini A, Salomaa V, Sarin AP, Schlessinger D, Scott RJ, Snieder H, St Pourcain B, Starr JM, Sul JH, Surakka I, Svento R, Teumer A, Tiemeier H, van Rooij FJ, Van Wagoner DR, Vartiainen E, Viikari J, Vollenweider P, Vonk JM, Waeber G, Weir DR, Wichmann HE, Widen E, Willemsen G, Wilson JF, Wright AF, Conley D, Davey-Smith G, Franke L, Groenen PJ, Hofman A, Johannesson M, Kardia SL, Krueger RF, Laibson D, Martin NG, Meyer MN, Posthuma D, Thurik AR, Timpson NJ, Uitterlinden AG, van Duijn CM, Visscher PM, Benjamin DJ, Cesarini D and Koellinger PD.
Journal Science 340 (6139), 1467-1471 (2013)
Title Identification of prognosis-relevant subgroups in patients with chemoresistant triple-negative breast cancer .
Author Yu KD, Zhu R, Zhan M, Rodriguez AA, Yang W, Wong S, Makris A, Lehmann BD, Chen X, Mayer I, Pietenpol JA, Shao ZM, Symmans WF and Chang JC.
Journal Clin. Cancer Res. 19 (10), 2723-2733 (2013)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila S, Froeling FE, Tan A, Bonnard C, Boland GJ, Snippe H, Hibberd ML and Seielstad M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors .
Author Heimbucher T, Murko C, Bajoghli B, Aghaallaei N, Huber A, Stebegg R, Eberhard D, Fink M, Simeone A and Czerny T.
Journal Mol. Cell. Biol. 27 (1), 340-351 (2007)
Title Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer .
Author Glinsky GV, Berezovska O and Glinskii AB.
Journal J. Clin. Invest. 115 (6), 1503-1521 (2005)
Title Enhanced GBX2 expression stimulates growth of human prostate cancer cells via transcriptional up-regulation of the interleukin 6 gene .
Author Gao AC, Lou W and Isaacs JT.
Journal Clin. Cancer Res. 6 (2), 493-497 (2000)
Title Down-regulation of homeobox gene GBX2 expression inhibits human prostate cancer clonogenic ability and tumorigenicity .
Author Gao AC, Lou W and Isaacs JT.
Journal Cancer Res. 58 (7), 1391-1394 (1998)
Title The homeobox gene GBX2, a target of the myb oncogene, mediates autocrine growth and monocyte differentiation .
Author Kowenz-Leutz E, Herr P, Niss K and Leutz A.
Journal Cell 91 (2), 185-195 (1997)
Title Characterization and sequence analysis of the human homeobox-containing gene GBX2 .
Author Lin X, Swaroop A, Vaccarino FM, Murtha MT, Haas M, Ji X, Ruddle FH and Leckman JF.
Journal Genomics 31 (3), 335-342 (1996)
Title The HOX complex neighbored by the EVX gene, as well as two other homeobox-containing genes, the GBX-class and the EN-class, are located on the same chromosomes 2 and 7 in humans .
Author Matsui T, Hirai M, Hirano M and Kurosawa Y.
Journal FEBS Lett. 336 (1), 107-110 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.