Sequence in raw or FASTA format:
Homo sapiens gastrulation brain homeobox 2 (GBX2), mRNA.
| RefSeq Version | NM_001485.2, 45593143 |
| Length | 1335 bp |
| Structure | linear |
| Update Date | 25-DEC-2010 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens gastrulation brain homeobox 2 (GBX2), mRNA. |
| Product | homeobox protein GBX-2 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF118452.1 and BF115559.1. On Mar 19, 2004 this sequence version replaced gi:4503940. |
| RefSeq | NP_001476.2 |
| CDS | 39..1085 | Exon (1) | 1..561 | Exon (2) | 562..1335 |
| Translation | MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP
PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE
AAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRG
QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGS
TTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA
KWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(398) | - | g, c | dbSNP:79285591 |
| 557 | + | c, g | dbSNP:112186240 |
| complement(611) | - | g, a | dbSNP:113549935 |
| complement(743) | - | t, g | dbSNP:113681406 |
| complement(815) | - | t, c | dbSNP:7588069 |
| complement(1007) | - | g, a | dbSNP:114693893 |
| complement(1011) | - | t, c | dbSNP:61743573 |
| complement(1155) | - | g, a | dbSNP:116291098 |
| Title | New genetic associations detected in a host response study to hepatitis B vaccine . |
| Author | Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M. |
| Journal | Genes Immun. 11 (3), 232-238 (2010) |
| Title | Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors . |
| Author | Heimbucher,T., Murko,C., Bajoghli,B., Aghaallaei,N., Huber,A., Stebegg,R., Eberhard,D., Fink,M., Simeone,A. and Czerny,T. |
| Journal | Mol. Cell. Biol. 27 (1), 340-351 (2007) |
| Title | Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer . |
| Author | Glinsky,G.V., Berezovska,O. and Glinskii,A.B. |
| Journal | J. Clin. Invest. 115 (6), 1503-1521 (2005) |
| Title | Generation and annotation of the DNA sequences of human chromosomes 2 and 4 . |
| Author | Hillier,L.W., Graves,T.A., Fulton,R.S., Fulton,L.A., Pepin,K.H., Minx,P., Wagner-McPherson,C., Layman,D., Wylie,K., Sekhon,M., Becker,M.C., Fewell,G.A., Delehaunty,K.D., Miner,T.L., Nash,W.E., Kremitzki,C., Oddy,L., Du,H., Sun,H., Bradshaw-Cordum,H., Ali,J., Carter,J., Cordes,M., Harris,A., Isak,A., van Brunt,A., Nguyen,C., Du,F., Courtney,L., Kalicki,J., Ozersky,P., Abbott,S., Armstrong,J., Belter,E.A., Caruso,L., Cedroni,M., Cotton,M., Davidson,T., Desai,A., Elliott,G., Erb,T., Fronick,C., Gaige,T., Haakenson,W., Haglund,K., Holmes,A., Harkins,R., Kim,K., Kruchowski,S.S., Strong,C.M., Grewal,N., Goyea,E., Hou,S., Levy,A., Martinka,S., Mead,K., McLellan,M.D., Meyer,R., Randall-Maher,J., Tomlinson,C., Dauphin-Kohlberg,S., Kozlowicz-Reilly,A., Shah,N., Swearengen-Shahid,S., Snider,J., Strong,J.T., Thompson,J., Yoakum,M., Leonard,S., Pearman,C., Trani,L., Radionenko,M., Waligorski,J.E., Wang,C., Rock,S.M., Tin-Wollam,A.M., Maupin,R., Latreille,P., Wendl,M.C., Yang,S.P., Pohl,C., Wallis,J.W., Spieth,J., Bieri,T.A., Berkowicz,N., Nelson,J.O., Osborne,J., Ding,L., Meyer,R., Sabo,A., Shotland,Y., Sinha,P., Wohldmann,P.E., Cook,L.L., Hickenbotham,M.T., Eldred,J., Williams,D., Jones,T.A., She,X., Ciccarelli,F.D., Izaurralde,E., Taylor,J., Schmutz,J., Myers,R.M., Cox,D.R., Huang,X., McPherson,J.D., Mardis,E.R., Clifton,S.W., Warren,W.C., Chinwalla,A.T., Eddy,S.R., Marra,M.A., Ovcharenko,I., Furey,T.S., Miller,W., Eichler,E.E., Bork,P., Suyama,M., Torrents,D., Waterston,R.H. and Wilson,R.K. |
| Journal | Nature 434 (7034), 724-731 (2005) |
| Title | Enhanced GBX2 expression stimulates growth of human prostate cancer cells via transcriptional up-regulation of the interleukin 6 gene . |
| Author | Gao,A.C., Lou,W. and Isaacs,J.T. |
| Journal | Clin. Cancer Res. 6 (2), 493-497 (2000) |
| Title | Down-regulation of homeobox gene GBX2 expression inhibits human prostate cancer clonogenic ability and tumorigenicity . |
| Author | Gao,A.C., Lou,W. and Isaacs,J.T. |
| Journal | Cancer Res. 58 (7), 1391-1394 (1998) |
| Title | The homeobox gene GBX2, a target of the myb oncogene, mediates autocrine growth and monocyte differentiation . |
| Author | Kowenz-Leutz,E., Herr,P., Niss,K. and Leutz,A. |
| Journal | Cell 91 (2), 185-195 (1997) |
| Title | Characterization and sequence analysis of the human homeobox-containing gene GBX2 . |
| Author | Lin,X., Swaroop,A., Vaccarino,F.M., Murtha,M.T., Haas,M., Ji,X., Ruddle,F.H. and Leckman,J.F. |
| Journal | Genomics 31 (3), 335-342 (1996) |
| Title | The HOX complex neighbored by the EVX gene, as well as two other homeobox-containing genes, the GBX-class and the EN-class, are located on the same chromosomes 2 and 7 in humans . |
| Author | Matsui,T., Hirai,M., Hirano,M. and Kurosawa,Y. |
| Journal | FEBS Lett. 336 (1), 107-110 (1993) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |