• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens gastrulation brain homeobox 2 (GBX2), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001485 Homo sapiens gastrulation brain homeobox 2 (GBX2), mRNA. Full Lenth $387.15
ORF Sequence $303.63


RefSeq Version NM_001485.2, 45593143
Length 1335 bp
Structure linear
Update Date 25-DEC-2010
Organism Homo sapiens (human)
Definition Homo sapiens gastrulation brain homeobox 2 (GBX2), mRNA.
Product homeobox protein GBX-2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF118452.1 and BF115559.1. On Mar 19, 2004 this sequence version replaced gi:4503940.

RefSeq NP_001476.2
CDS 39..1085
Exon (1)1..561
Exon (2)562..1335
Translation MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE AAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRG QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGS TTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA KWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(398)-g, cdbSNP:79285591
557+c, gdbSNP:112186240
complement(611)-g, adbSNP:113549935
complement(743)-t, gdbSNP:113681406
complement(815)-t, cdbSNP:7588069
complement(1007)-g, adbSNP:114693893
complement(1011)-t, cdbSNP:61743573
complement(1155)-g, adbSNP:116291098
Gene SymbolGBX2
Gene SynonymGBX2
Chromosome2
Locus Map2q37
All Transcripts NM_001485
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors .
Author Heimbucher,T., Murko,C., Bajoghli,B., Aghaallaei,N., Huber,A., Stebegg,R., Eberhard,D., Fink,M., Simeone,A. and Czerny,T.
Journal Mol. Cell. Biol. 27 (1), 340-351 (2007)
Title Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer .
Author Glinsky,G.V., Berezovska,O. and Glinskii,A.B.
Journal J. Clin. Invest. 115 (6), 1503-1521 (2005)
Title Generation and annotation of the DNA sequences of human chromosomes 2 and 4 .
Author Hillier,L.W., Graves,T.A., Fulton,R.S., Fulton,L.A., Pepin,K.H., Minx,P., Wagner-McPherson,C., Layman,D., Wylie,K., Sekhon,M., Becker,M.C., Fewell,G.A., Delehaunty,K.D., Miner,T.L., Nash,W.E., Kremitzki,C., Oddy,L., Du,H., Sun,H., Bradshaw-Cordum,H., Ali,J., Carter,J., Cordes,M., Harris,A., Isak,A., van Brunt,A., Nguyen,C., Du,F., Courtney,L., Kalicki,J., Ozersky,P., Abbott,S., Armstrong,J., Belter,E.A., Caruso,L., Cedroni,M., Cotton,M., Davidson,T., Desai,A., Elliott,G., Erb,T., Fronick,C., Gaige,T., Haakenson,W., Haglund,K., Holmes,A., Harkins,R., Kim,K., Kruchowski,S.S., Strong,C.M., Grewal,N., Goyea,E., Hou,S., Levy,A., Martinka,S., Mead,K., McLellan,M.D., Meyer,R., Randall-Maher,J., Tomlinson,C., Dauphin-Kohlberg,S., Kozlowicz-Reilly,A., Shah,N., Swearengen-Shahid,S., Snider,J., Strong,J.T., Thompson,J., Yoakum,M., Leonard,S., Pearman,C., Trani,L., Radionenko,M., Waligorski,J.E., Wang,C., Rock,S.M., Tin-Wollam,A.M., Maupin,R., Latreille,P., Wendl,M.C., Yang,S.P., Pohl,C., Wallis,J.W., Spieth,J., Bieri,T.A., Berkowicz,N., Nelson,J.O., Osborne,J., Ding,L., Meyer,R., Sabo,A., Shotland,Y., Sinha,P., Wohldmann,P.E., Cook,L.L., Hickenbotham,M.T., Eldred,J., Williams,D., Jones,T.A., She,X., Ciccarelli,F.D., Izaurralde,E., Taylor,J., Schmutz,J., Myers,R.M., Cox,D.R., Huang,X., McPherson,J.D., Mardis,E.R., Clifton,S.W., Warren,W.C., Chinwalla,A.T., Eddy,S.R., Marra,M.A., Ovcharenko,I., Furey,T.S., Miller,W., Eichler,E.E., Bork,P., Suyama,M., Torrents,D., Waterston,R.H. and Wilson,R.K.
Journal Nature 434 (7034), 724-731 (2005)
Title Enhanced GBX2 expression stimulates growth of human prostate cancer cells via transcriptional up-regulation of the interleukin 6 gene .
Author Gao,A.C., Lou,W. and Isaacs,J.T.
Journal Clin. Cancer Res. 6 (2), 493-497 (2000)
Title Down-regulation of homeobox gene GBX2 expression inhibits human prostate cancer clonogenic ability and tumorigenicity .
Author Gao,A.C., Lou,W. and Isaacs,J.T.
Journal Cancer Res. 58 (7), 1391-1394 (1998)
Title The homeobox gene GBX2, a target of the myb oncogene, mediates autocrine growth and monocyte differentiation .
Author Kowenz-Leutz,E., Herr,P., Niss,K. and Leutz,A.
Journal Cell 91 (2), 185-195 (1997)
Title Characterization and sequence analysis of the human homeobox-containing gene GBX2 .
Author Lin,X., Swaroop,A., Vaccarino,F.M., Murtha,M.T., Haas,M., Ji,X., Ruddle,F.H. and Leckman,J.F.
Journal Genomics 31 (3), 335-342 (1996)
Title The HOX complex neighbored by the EVX gene, as well as two other homeobox-containing genes, the GBX-class and the EN-class, are located on the same chromosomes 2 and 7 in humans .
Author Matsui,T., Hirai,M., Hirano,M. and Kurosawa,Y.
Journal FEBS Lett. 336 (1), 107-110 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878