• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_001511 Homo sapiens chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), transcript variant 1, mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001511.3, 373432598
Length 1184 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), transcript variant 1, mRNA.
Product growth-regulated alpha protein precursor
Comment

Summary: This gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signal through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Jan 2012].


Transcript Variant: This variant (1) encodes the functional protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001502.1
CDS 80..403
Misc Feature(1)197..385
Misc Feature(2)order(197..205,221..223,233..250,275..283,311..316,
Misc Feature(3)197..205
Misc Feature(4)order(200..202,209..211,248..253,260..268,296..307,
Misc Feature(5)order(200..202,209..211,260..262,266..268,296..298,
Misc Feature(6)200..202
Misc Feature(7)order(203..208,212..214)
Misc Feature(8)order(209..229,233..250)
Misc Feature(9)order(215..220,224..226,233..235,245..247,302..304,
Misc Feature(10)order(236..238,242..244,344..346,353..355,359..370,
Misc Feature(11)order(242..244,251..253,308..310,314..316,323..328)
Misc Feature(12)order(248..253,263..265,299..301,305..307,335..337,
Misc Feature(13)263..265
Misc Feature(14)275..283
Misc Feature(15)275..283
Misc Feature(16)314..322
Exon (1)1..179
Gene:CXCL1
Gene Synonym:FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1
Exon (2)180..303
Gene:CXCL1
Gene Synonym:FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1
Exon (3)304..387
Gene:CXCL1
Gene Synonym:FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1
Exon (4)388..1169
Gene:CXCL1
Gene Synonym:FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1
Translation MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Gene SymbolCXCL1
Gene SynonymFSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1
Chromosome4
Locus Map4q21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001511 Homo sapiens chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), transcript variant 1, mRNA. Full Length $343.36
ORF Sequence $159.00
Title Plasma levels of CXCL1 (GRO-alpha) and CXCL10 (IP-10) are elevated in type 2 diabetic patients: evidence for the involvement of inflammation and angiogenesis/angiostasis in this disease state .
Author Sajadi,S.M., Khoramdelazad,H., Hassanshahi,G., Rafatpanah,H., Hosseini,J., Mahmoodi,M., Arababadi,M.K., Derakhshan,R., Hasheminasabzavareh,R., Hosseini-Zijoud,S.M. and Ahmadi,Z.
Journal Clin. Lab. 59 (1-2), 133-137 (2013)
Title Upregulation of chemokines and their receptors in Duchenne muscular dystrophy: potential for attenuation of myofiber necrosis .
Author De Paepe,B., Creus,K.K., Martin,J.J. and De Bleecker,J.L.
Journal Muscle Nerve 46 (6), 917-925 (2012)
Title CXCL1/GROalpha increases cell migration and invasion of prostate cancer by decreasing fibulin-1 expression through NF-kappaB/HDAC1 epigenetic regulation .
Author Kuo,P.L., Shen,K.H., Hung,S.H. and Hsu,Y.L.
Journal Carcinogenesis 33 (12), 2477-2487 (2012)
Title Physical mapping of the CXC chemokine locus on human chromosome 4 .
Author O'Donovan,N., Galvin,M. and Morgan,J.G.
Journal Cytogenet. Cell Genet. 84 (1-2), 39-42 (1999)
Title Purification, receptor binding analysis, and biological characterization of human melanoma growth stimulating activity (MGSA). Evidence for a novel MGSA receptor .
Author Horuk,R., Yansura,D.G., Reilly,D., Spencer,S., Bourell,J., Henzel,W., Rice,G. and Unemori,E.
Journal J. Biol. Chem. 268 (1), 541-546 (1993)
Title Characterization of two high affinity human interleukin-8 receptors .
Author Lee,J., Horuk,R., Rice,G.C., Bennett,G.L., Camerato,T. and Wood,W.I.
Journal J. Biol. Chem. 267 (23), 16283-16287 (1992)
Title An NF-kappa B-like transcription factor mediates IL-1/TNF-alpha induction of gro in human fibroblasts .
Author Anisowicz,A., Messineo,M., Lee,S.W. and Sager,R.
Journal J. Immunol. 147 (2), 520-527 (1991)
Title Nucleotide sequence of the human melanoma growth stimulatory activity (MGSA) gene .
Author Baker,N.E., Kucera,G. and Richmond,A.
Journal Nucleic Acids Res. 18 (21), 6453 (1990)
Title Lipopolysaccharide-stimulated human monocytes secrete, apart from neutrophil-activating peptide 1/interleukin 8, a second neutrophil-activating protein. NH2-terminal amino acid sequence identity with melanoma growth stimulatory activity .
Author Schroder,J.M., Persoon,N.L. and Christophers,E.
Journal J. Exp. Med. 171 (4), 1091-1100 (1990)
Title Molecular characterization and chromosomal mapping of melanoma growth stimulatory activity, a growth factor structurally related to beta-thromboglobulin .
Author Richmond,A., Balentien,E., Thomas,H.G., Flaggs,G., Barton,D.E., Spiess,J., Bordoni,R., Francke,U. and Derynck,R.
Journal EMBO J. 7 (7), 2025-2033 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878