Homo sapiens chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), mRNA.
| RefSeq Version | NM_001511.2, 292781859 |
| Length | 1119 bp |
| Structure | linear |
| Update Date | 01-MAY-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), mRNA. |
| Product | growth-regulated alpha protein precursor |
| Comment | Summary: Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif. ELR types are chemotactic for neutrophils, while non-ELR types are chemotactic for lymphocytes.[supplied by OMIM]. |
| RefSeq | NP_001502.1 |
| CDS | 80..403 | Exon (1) | 1..179 | Exon (2) | 1..179 | Exon (3) | 180..303 | Exon (4) | 304..387 | Exon (5) | 388..1109 |
| Translation | MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 42 | + | g, t | dbSNP:11547681 |
| 136 | + | a, g | dbSNP:2071425 |
| 149 | + | a, c | dbSNP:13104984 |
| 503..504 | + | , g | dbSNP:34849214 |
| 785 | + | c, t | dbSNP:113554285 |
| 798 | + | c, g | dbSNP:75368992 |
| 801 | + | a, g | dbSNP:75414182 |
| 853 | + | a, g | dbSNP:112791438 |
| 863 | + | c, t | dbSNP:111913680 |
| 864 | + | g, t | dbSNP:116303802 |
| 1055 | + | c, t | dbSNP:1957068 |
| Gene Symbol | CXCL1 |
| Gene Synonym | FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1 |
| Chromosome | 4 |
| Locus Map | 4q21 |
| All Transcripts | NM_001511 |
| Title | Chemokine transcripts as targets of the RNA-binding protein HuR in human airway epithelium . |
| Author | Fan,J., Ishmael,F.T., Fang,X., Myers,A., Cheadle,C., Huang,S.K., Atasoy,U., Gorospe,M. and Stellato,C. |
| Journal | J. Immunol. 186 (4), 2482-2494 (2011) |
| Title | Serglycin is a major proteoglycan in polarized human endothelial cells and is implicated in the secretion of the chemokine GROalpha/CXCL1 . |
| Author | Meen,A.J., Oynebraten,I., Reine,T.M., Duelli,A., Svennevig,K., Pejler,G., Jenssen,T. and Kolset,S.O. |
| Journal | J. Biol. Chem. 286 (4), 2636-2647 (2011) |
| Title | GROalpha promotes invasion of colorectal cancer cells . |
| Author | Ogata,H., Sekikawa,A., Yamagishi,H., Ichikawa,K., Tomita,S., Imura,J., Ito,Y., Fujita,M., Tsubaki,M., Kato,H., Fujimori,T. and Fukui,H. |
| Journal | Oncol. Rep. 24 (6), 1479-1486 (2010) |
| Title | The chemokine CXCL1 induces proliferation in epithelial ovarian cancer cells by transactivation of the epidermal growth factor receptor . |
| Author | Bolitho,C., Hahn,M.A., Baxter,R.C. and Marsh,D.J. |
| Journal | Endocr. Relat. Cancer 17 (4), 929-940 (2010) |
| Title | Chemokine growth-regulated oncogene 1 as a putative biomarker for gastric cancer progression . |
| Author | Jung,J.J., Noh,S., Jeung,H.C., Jung,M., Kim,T.S., Noh,S.H., Roh,J.K., Chung,H.C. and Rha,S.Y. |
| Journal | Cancer Sci. 101 (10), 2200-2206 (2010) |
| Title | Characterization of two high affinity human interleukin-8 receptors . |
| Author | Lee,J., Horuk,R., Rice,G.C., Bennett,G.L., Camerato,T. and Wood,W.I. |
| Journal | J. Biol. Chem. 267 (23), 16283-16287 (1992) |
| Title | An NF-kappa B-like transcription factor mediates IL-1/TNF-alpha induction of gro in human fibroblasts . |
| Author | Anisowicz,A., Messineo,M., Lee,S.W. and Sager,R. |
| Journal | J. Immunol. 147 (2), 520-527 (1991) |
| Title | Nucleotide sequence of the human melanoma growth stimulatory activity (MGSA) gene . |
| Author | Baker,N.E., Kucera,G. and Richmond,A. |
| Journal | Nucleic Acids Res. 18 (21), 6453 (1990) |
| Title | Identification of three related human GRO genes encoding cytokine functions . |
| Author | Haskill,S., Peace,A., Morris,J., Sporn,S.A., Anisowicz,A., Lee,S.W., Smith,T., Martin,G., Ralph,P. and Sager,R. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 87 (19), 7732-7736 (1990) |
| Title | Lipopolysaccharide-stimulated human monocytes secrete, apart from neutrophil-activating peptide 1/interleukin 8, a second neutrophil-activating protein. NH2-terminal amino acid sequence identity with melanoma growth stimulatory activity . |
| Author | Schroder,J.M., Persoon,N.L. and Christophers,E. |
| Journal | J. Exp. Med. 171 (4), 1091-1100 (1990) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |