• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens actin, gamma 1 (ACTG1), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu50626 Homo sapiens actin, gamma 1 (ACTG1), transcript variant 2, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu50626C Homo sapiens actin, gamma 1 (ACTG1), transcript variant 2, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001614.3, 316659407
Length 1128 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens actin, gamma 1 (ACTG1), transcript variant 2, mRNA.
Product actin, cytoplasmic 2
Comment

Summary: Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 1, encoded by this gene, is a cytoplasmic actin found in non-muscle cells. Mutations in this gene are associated with DFNA20/26, a subtype of autosomal dominant non-syndromic sensorineural progressive hearing loss. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011].


Transcript Variant: This variant (2) differs in the 5' UTR, compared to variant 1. Variants 1 and 2 encode the same protein.

RefSeq NP_001605.1
CDS 140..1267
Misc Feature(1)38..40
Misc Feature(2)38..40
Misc Feature(3)140..142
Misc Feature(4)140..142
Misc Feature(5)143..145
Misc Feature(6)146..1264
Misc Feature(7)161..682
Misc Feature(8)order(170..181,185..187,191..193,548..550,599..610)
Misc Feature(9)356..358
Misc Feature(10)389..391
Misc Feature(11)788..790
Exon (1)1..133
Gene:ACTG1
Gene Synonym:ACT; ACTG; BRWS2; DFNA20; DFNA26; HEL-176
Exon (2)134..262
Gene:ACTG1
Gene Synonym:ACT; ACTG; BRWS2; DFNA20; DFNA26; HEL-176
Exon (3)263..502
Gene:ACTG1
Gene Synonym:ACT; ACTG; BRWS2; DFNA20; DFNA26; HEL-176
Exon (4)503..941
Gene:ACTG1
Gene Synonym:ACT; ACTG; BRWS2; DFNA20; DFNA26; HEL-176
Exon (5)942..1123
Gene:ACTG1
Gene Synonym:ACT; ACTG; BRWS2; DFNA20; DFNA26; HEL-176
Exon (6)1124..1986
Gene:ACTG1
Gene Synonym:ACT; ACTG; BRWS2; DFNA20; DFNA26; HEL-176
Translation MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
85+a, gdbSNP:7503278
101+c, tdbSNP:1139403
complement(108)-g, adbSNP:75739711
109..110+c, gdbSNP:11549207
complement(109)-g, cdbSNP:143315390
113..114+a, cdbSNP:11549240
complement(116)-g, adbSNP:149163199
117..118+g, tdbSNP:11549198
complement(136)-dbSNP:
complement(136)-g, adbSNP:371557875
complement(137)-t, cdbSNP:200999469
144+a, gdbSNP:11549194
complement(148)-t, cdbSNP:375069806
complement(151)-g, cdbSNP:201579883
complement(154)-t, g, adbSNP:199657153
complement(157)-g, adbSNP:145211830
complement(175)-g, adbSNP:201420091
complement(178)-g, adbSNP:146865914
181+c, tdbSNP:11549195
complement(184)-g, adbSNP:145574149
185+a, gdbSNP:11549241
complement(190)-g, adbSNP:201570725
complement(195)-g, adbSNP:375334153
complement(204)-g, cdbSNP:199524509
complement(205)-c, adbSNP:149682185
complement(211)-g, adbSNP:139517777
complement(216)-t, gdbSNP:371967814
217+c, tdbSNP:11549228
220+a, c, tdbSNP:11549230
complement(225)-g, adbSNP:375159565
226+a, cdbSNP:11549232
227+a, gdbSNP:11549243
complement(230)-g, adbSNP:202102245
234+a, cdbSNP:11549231
complement(235)-t, adbSNP:199955399
238+a, c, tdbSNP:11549238
244+c, tdbSNP:11549193
252+c, tdbSNP:11549244
258+a, gdbSNP:11549236
259+c, g, tdbSNP:11549174
265+dbSNP:
265+c, tdbSNP:11549197
complement(276)-t, cdbSNP:200210656
complement(277)-g, adbSNP:374907377
280+a, gdbSNP:11549215
complement(280)-g, adbSNP:386519025
281+c, gdbSNP:11549214
complement(298)-g, adbSNP:139751304
300+g, tdbSNP:11549216
complement(304)-g, adbSNP:146402466
complement(307)-g, adbSNP:368299537
complement(310)-t, cdbSNP:372586603
315+a, tdbSNP:11549199
316+a, gdbSNP:11549220
complement(318)-t, cdbSNP:148759022
complement(319)-g, adbSNP:144338558
328+c, tdbSNP:11549245
complement(329)-t, adbSNP:140152735
complement(331)-t, gdbSNP:138240892
complement(337)-g, adbSNP:147032031
338+c, tdbSNP:11549224
341+a, tdbSNP:11549233
complement(349)-g, adbSNP:201275526
360+c, gdbSNP:11549185
complement(361)-g, adbSNP:368844224
complement(367)-g, adbSNP:143028649
complement(370)-g, adbSNP:375450454
complement(391)-t, cdbSNP:139059365
complement(394)-g, adbSNP:147001458
405+c, tdbSNP:28999111
complement(406)-g, adbSNP:140398667
409+c, g, tdbSNP:11549209
437+c, gdbSNP:11549188
439+a, gdbSNP:11549239
443+a, cdbSNP:11549229
444+c, tdbSNP:11549172
complement(454)-t, cdbSNP:202094234
complement(457)-g, cdbSNP:372370199
462+c, tdbSNP:11549181
474+c, tdbSNP:11549176
complement(478)-t, cdbSNP:200292222
complement(484)-g, adbSNP:149057480
complement(490)-t, cdbSNP:200772616
492+a, tdbSNP:104894544
493+c, gdbSNP:267606630
complement(497)-t, cdbSNP:202103644
498+c, tdbSNP:281875325
503+dbSNP:
503+a, gdbSNP:281875330
complement(505)-g, adbSNP:199507088
517+c, tdbSNP:11549201
532+a, c, tdbSNP:11150794
538+c, tdbSNP:2230158
543+c, tdbSNP:11549190
552+c, tdbSNP:11549180
complement(553)-g, adbSNP:143978597
562+c, g, tdbSNP:11549226
complement(565)-g, adbSNP:112043655
569+g, tdbSNP:11549196
complement(571)-g, adbSNP:372748659
588+g, tdbSNP:11549175
complement(589)-g, adbSNP:368452194
595+c, tdbSNP:11549208
complement(597)-c, adbSNP:140176659
603+c, tdbSNP:281875326
604+g, tdbSNP:11549227
610+c, tdbSNP:11549222
618+c, tdbSNP:11549206
complement(622)-g, adbSNP:368809840
complement(637)-g, adbSNP:373572370
652..653+c, tdbSNP:11549192
654+c, tdbSNP:11549177
complement(664)-g, adbSNP:146667866
complement(670)-g, adbSNP:143851458
complement(673)-t, cdbSNP:140035543
complement(685)-g, adbSNP:61997063
complement(688)-g, cdbSNP:372188662
complement(697)-g, adbSNP:142893042
complement(703)-g, adbSNP:141964376
complement(715)-g, adbSNP:186443800
complement(745)-g, adbSNP:201241272
747+a, cdbSNP:281875327
complement(748)-t, cdbSNP:148528303
750+c, tdbSNP:11549225
complement(751)-g, adbSNP:368022367
755..756+c, gdbSNP:11549212
complement(757)-t, cdbSNP:375061969
complement(763)-t, gdbSNP:370369574
complement(769)-g, adbSNP:202020778
complement(778)-t, cdbSNP:147475815
complement(787)-t, cdbSNP:374707507
complement(793)-g, adbSNP:182162229
799+c, tdbSNP:11549205
complement(805)-g, adbSNP:376839455
complement(808)-g, adbSNP:373099591
complement(814)-t, cdbSNP:370618663
complement(823)-g, adbSNP:143125497
complement(826)-g, adbSNP:201036516
829+c, g, tdbSNP:11549213
complement(835)-g, adbSNP:202155328
complement(838)-g, adbSNP:146367733
840+c, tdbSNP:11549179
complement(845)-g, adbSNP:61997064
853+a, c, gdbSNP:11549173
complement(859)-g, adbSNP:376038784
860+a, gdbSNP:267606631
861..862+a, gdbSNP:11549235
868+c, tdbSNP:2230159
complement(874)-g, adbSNP:186289501
875+c, tdbSNP:11549178
complement(879)-c, adbSNP:201821915
891+c, gdbSNP:11549202
899+c, tdbSNP:281875328
905+c, tdbSNP:281875329
912+c, tdbSNP:11549191
complement(913)-t, cdbSNP:61997068
complement(919)-t, cdbSNP:140846345
930+c, tdbSNP:104894546
complement(932)-c, adbSNP:375647200
complement(934)-g, adbSNP:146493032
complement(937)-g, adbSNP:377628364
complement(938)-g, adbSNP:372364479
complement(941)-g, cdbSNP:200506997
complement(955)-dbSNP:
complement(955)-g, adbSNP:376841359
complement(964)-g, adbSNP:145303691
972+c, tdbSNP:28999112
complement(973)-g, adbSNP:140289614
complement(976)-g, adbSNP:77274428
complement(979)-g, adbSNP:146663750
complement(997)-g, adbSNP:201277295
1015+c, tdbSNP:11549211
complement(1016)-g, adbSNP:143205514
1038+c, tdbSNP:11549204
complement(1039)-t, cdbSNP:367966804
complement(1042)-g, adbSNP:201963572
complement(1048)-g, adbSNP:187127467
1057+c, tdbSNP:1139405
complement(1063)-g, adbSNP:371738013
1069+c, tdbSNP:1135989
complement(1072)-g, adbSNP:150067150
1093+c, g, tdbSNP:3211110
complement(1096)-g, adbSNP:377745600
1108+c, tdbSNP:11549187
complement(1117)-t, cdbSNP:139339869
1130+dbSNP:
1130+c, gdbSNP:11549200
1133+c, gdbSNP:104894545
complement(1135)-t, gdbSNP:200089021
complement(1141)-t, cdbSNP:113262912
complement(1153)-g, adbSNP:1139807
complement(1156)-g, cdbSNP:111305526
complement(1162)-g, adbSNP:140865670
complement(1165)-t, cdbSNP:1139406
complement(1168)-g, adbSNP:143659814
1179+c, tdbSNP:11549186
complement(1180)-g, cdbSNP:375903517
complement(1192)-g, adbSNP:148267855
complement(1225)-g, adbSNP:144114953
complement(1234)-t, cdbSNP:201121917
complement(1246)-g, adbSNP:372665803
complement(1247)-t, cdbSNP:201509098
1248+c, tdbSNP:104894547
complement(1252)-t, cdbSNP:386435897
complement(1252)-g, adbSNP:117765323
complement(1261)-g, adbSNP:369020026
complement(1264)-g, adbSNP:376976044
1267+a, gdbSNP:11549223
complement(1269)-g, adbSNP:373771602
complement(1284)-g, adbSNP:369896605
complement(1295)-g, adbSNP:373653529
complement(1310)-t, cdbSNP:369444120
complement(1312)-t, cdbSNP:376197836
complement(1315)-g, adbSNP:372830826
complement(1379)-g, adbSNP:368494254
complement(1393)-g, cdbSNP:140458109
complement(1401)-g, adbSNP:28478053
complement(1408)-g, adbSNP:55978907
complement(1413)-t, cdbSNP:11549165
complement(1414)-g, adbSNP:369082132
complement(1450)-g, adbSNP:191155019
complement(1452)-g, adbSNP:11549163
complement(1459)-g, cdbSNP:55902924
complement(1466)-t, adbSNP:188302477
complement(1471)-g, adbSNP:11549168
complement(1494)-g, adbSNP:184661152
1517+c, tdbSNP:3369
complement(1549)-g, adbSNP:193006971
complement(1551)-t, cdbSNP:11549167
complement(1552)-t, cdbSNP:188346431
1581+c, tdbSNP:11549182
complement(1596)-t, adbSNP:145366956
complement(1602)-g, adbSNP:183500955
1604+c, gdbSNP:1063817
1606+c, tdbSNP:11549183
complement(1615)-t, gdbSNP:11549171
1627+a, gdbSNP:1140892
complement(1632)-g, adbSNP:11549170
1637+a, gdbSNP:1139408
1662+c, tdbSNP:11549221
complement(1692..1693)-, adbSNP:370264981
complement(1693..1694)-, adbSNP:143167427
complement(1734)-t, cdbSNP:11549169
complement(1737)-g, adbSNP:192243286
1749+c, tdbSNP:1140383
complement(1767)-g, adbSNP:117115846
complement(1787..1788)-, tdbSNP:199526522
1792+c, tdbSNP:1139409
1793+c, tdbSNP:1139410
complement(1821)-g, adbSNP:11549161
1822+a, c, tdbSNP:11549203
complement(1842)-t, adbSNP:187751050
1851+c, tdbSNP:150946913
1867+a, gdbSNP:7502276
complement(1875)-t, gdbSNP:183520259
1884+a, gdbSNP:1139414
complement(1897)-t, gdbSNP:189747787
complement(1916)-t, cdbSNP:11549162
complement(1920)-g, adbSNP:186261668
complement(1928)-g, adbSNP:11549164
complement(1942)-t, gdbSNP:139505254
complement(1946)-g, adbSNP:147350493
complement(1979)-t, cdbSNP:182942453
complement(1981)-t, cdbSNP:112938785
Gene SymbolACTG1
Gene SynonymACT; ACTG; BRWS2; DFNA20; DFNA26; HEL-176
Chromosome17
Locus Map17q25
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001199954 Homo sapiens actin, gamma 1 (ACTG1), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_001614 Homo sapiens actin, gamma 1 (ACTG1), transcript variant 2, mRNA. In-stock $99.00 5-7
XM_006722048 PREDICTED: Homo sapiens actin, gamma 1 (ACTG1), transcript variant X1, mRNA. On-demand TBD TBD
XM_006722049 PREDICTED: Homo sapiens actin, gamma 1 (ACTG1), transcript variant X2, mRNA. On-demand TBD TBD
Title Multiphasic analysis of whole exome sequencing data identifies a novel mutation of ACTG1 in a nonsyndromic hearing loss family .
Author Park G, Gim J, Kim AR, Han KH, Kim HS, Oh SH, Park T, Park WY and Choi BY.
Journal BMC Genomics 14, 191 (2013)
Title Nonredundant roles of cytoplasmic beta- and gamma-actin isoforms in regulation of epithelial apical junctions .
Author Baranwal S, Naydenov NG, Harris G, Dugina V, Morgan KG, Chaponnier
Journal Mol. Biol. Cell 23 (18), 3542-3553 (2012)
Title Cofilin 1-mediated biphasic F-actin dynamics of neuronal cells affect herpes simplex virus 1 infection and replication .
Author Xiang Y, Zheng K, Ju H, Wang S, Pei Y, Ding W, Chen Z, Wang Q, Qiu X, Zhong M, Zeng F, Ren Z, Qian C, Liu G, Kitazato K and Wang Y.
Journal J. Virol. 86 (16), 8440-8451 (2012)
Title De novo mutations in the actin genes ACTB and ACTG1 cause Baraitser-Winter syndrome .
Author Riviere JB, van Bon BW, Hoischen A, Kholmanskikh SS, O'Roak BJ, Gilissen C, Gijsen S, Sullivan CT, Christian SL, Abdul-Rahman OA, Atkin JF, Chassaing N, Drouin-Garraud V, Fry AE, Fryns JP, Gripp KW, Kempers M, Kleefstra T, Mancini GM, Nowaczyk MJ, van Ravenswaaij-Arts CM, Roscioli T, Marble M, Rosenfeld JA, Siu VM, de Vries BB, Shendure J, Verloes A, Veltman JA, Brunner HG, Ross ME, Pilz DT and Dobyns WB.
Journal Nat. Genet. 44 (4), 440-444 (2012)
Title gamma-Actin regulates cell migration and modulates the ROCK signaling pathway .
Author Shum MS, Pasquier E, Po'uha ST, O'Neill GM, Chaponnier C, Gunning
Journal FASEB J. 25 (12), 4423-4433 (2011)
Title Deafness and Hereditary Hearing Loss Overview .
Author Smith,R.J.H., Shearer,A.E., Hildebrand,M.S. and Van Camp,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Ca2+ and pH determine the interaction of chromaffin cell scinderin with phosphatidylserine and phosphatidylinositol 4,5,-biphosphate and its cellular distribution during nicotinic-receptor stimulation and protein kinase C activation .
Author Rodriguez Del Castillo A, Vitale ML and Trifaro JM.
Journal J. Cell Biol. 119 (4), 797-810 (1992)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson SJ and White LA.
Journal J. Infect. 24 (3), 317-320 (1992)
Title Structure, chromosome location, and expression of the human gamma-actin gene: differential evolution, location, and expression of the cytoskeletal beta- and gamma-actin genes .
Author Erba HP, Eddy R, Shows T, Kedes L and Gunning P.
Journal Mol. Cell. Biol. 8 (4), 1775-1789 (1988)
Title Botulinum C2 toxin ADP-ribosylates cytoplasmic beta/gamma-actin in arginine 177 .
Author Vandekerckhove J, Schering B, Barmann M and Aktories K.
Journal J. Biol. Chem. 263 (2), 696-700 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.