• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23388 Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu23388C Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001648.2, 22208990
Length 786 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA.
Product prostate-specific antigen isoform 1 preproprotein
Comment

Summary: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longest isoform (1) of this protein.

RefSeq NP_001639.1
CDS 42..827
Misc Feature(1)111..800
Misc Feature(2)114..809
Misc Feature(3)114..116
Misc Feature(4)order(234..236,399..401,678..680)
Misc Feature(5)246..248
Misc Feature(6)273..275
Misc Feature(7)282..284
Misc Feature(8)546..548
Misc Feature(9)order(660..662,723..725,729..731)
Exon (1)1..87
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Exon (2)88..247
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Exon (3)248..534
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Exon (4)535..671
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Exon (5)672..1464
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Translation MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP SLYTKVVHYRKWIKDTIVANP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
3+dbSNP:
3+c, tdbSNP:371797932
17+c, tdbSNP:370025467
25+c, tdbSNP:199680464
40+c, tdbSNP:373854842
50+c, tdbSNP:201712212
52+c, tdbSNP:111689449
53+a, gdbSNP:375104394
67+a, cdbSNP:368127664
73+c, tdbSNP:138400533
89..90+dbSNP:
89..90+c, tdbSNP:17849961
89+c, tdbSNP:11573
91+c, tdbSNP:181375335
95+a, gdbSNP:1135766
111+c, tdbSNP:141576693
112+a, gdbSNP:147446084
115+c, tdbSNP:375110405
122+a, cdbSNP:200846924
134+c, tdbSNP:139911579
complement(135)-t, cdbSNP:2271092
157+a, tdbSNP:200712655
158+a, gdbSNP:7252245
169+a, cdbSNP:140318583
170+c, gdbSNP:374094231
175+a, gdbSNP:139560851
183+a, gdbSNP:149709822
187..188+, adbSNP:34953540
191+c, tdbSNP:144294681
194..195+, gggdbSNP:375428882
194+c, tdbSNP:201710884
195+a, gdbSNP:369223448
237+c, tdbSNP:371595805
255+dbSNP:
255+a, gdbSNP:148892721
263+a, gdbSNP:150517791
270+c, tdbSNP:146422657
271+a, gdbSNP:140831892
278+c, tdbSNP:12946
279+c, tdbSNP:17849962
300+c, gdbSNP:138565183
341+c, gdbSNP:2739452
344+c, tdbSNP:374344392
345+a, gdbSNP:61752561
398+c, tdbSNP:377532899
411+c, tdbSNP:201390347
414+c, tdbSNP:61750343
431+c, tdbSNP:201110725
432+a, gdbSNP:182759459
435+g, tdbSNP:2003783
439+c, tdbSNP:373661565
447+a, gdbSNP:149427770
488+a, gdbSNP:147547638
500+c, tdbSNP:376483907
501+a, gdbSNP:138273452
504..505+, tdbSNP:370161423
519+a, tdbSNP:200126385
525+c, tdbSNP:112372888
530+a, gdbSNP:143868213
541+dbSNP:
541+c, tdbSNP:367976209
566+c, tdbSNP:202206082
569+c, gdbSNP:148735869
572+c, tdbSNP:372190695
577+c, tdbSNP:17632542
587+c, tdbSNP:372148450
588+a, gdbSNP:150769385
596+a, gdbSNP:376510386
615+g, tdbSNP:376934756
629+c, gdbSNP:139172057
641+a, c, gdbSNP:1803129
644+c, tdbSNP:370658603
646+g, tdbSNP:187449592
647+g, tdbSNP:191588971
649+c, tdbSNP:146528783
670+c, gdbSNP:61729813
675+dbSNP:
675+a, gdbSNP:151298874
704+c, tdbSNP:140564011
721+c, tdbSNP:138882542
722+a, gdbSNP:61736309
730+a, gdbSNP:200116262
740+a, gdbSNP:79245399
750+a, cdbSNP:144118163
752+c, tdbSNP:146297845
753+a, gdbSNP:372901531
761+c, tdbSNP:45552633
767+a, gdbSNP:113126792
786+c, tdbSNP:1802720
790+a, gdbSNP:149376489
808+c, tdbSNP:144748315
812+c, tdbSNP:375475599
813+a, gdbSNP:200006942
842+c, tdbSNP:1058205
852+a, gdbSNP:373134993
857+a, gdbSNP:374859717
866+c, tdbSNP:368035787
877+c, gdbSNP:112479005
886+c, gdbSNP:141498977
892+a, gdbSNP:1058274
904+a, tdbSNP:1803132
916+c, tdbSNP:1802722
918+c, tdbSNP:1141894
944+c, tdbSNP:116064912
951+a, gdbSNP:1802721
963+a, gdbSNP:116248649
964+a, cdbSNP:3180906
989+c, tdbSNP:16987771
1015+c, tdbSNP:1803138
1068+c, gdbSNP:190504941
1072+c, g, tdbSNP:12101
1105+a, gdbSNP:6998
1133+a, cdbSNP:16987775
1209+c, tdbSNP:1803136
1227+a, gdbSNP:1803135
1235+g, tdbSNP:370827372
1240+a, gdbSNP:193123776
1242+a, gdbSNP:377210991
1247+c, tdbSNP:1803134
1271+a, gdbSNP:12040
1287+a, gdbSNP:61269009
1324+c, tdbSNP:1803133
complement(1331)-t, cdbSNP:11554029
1342+a, gdbSNP:12863
1361+a, gdbSNP:1803137
complement(1366)-t, cdbSNP:11554028
1416+c, tdbSNP:11554027
Gene SymbolKLK3
Gene SynonymAPS; hK3; KLK2A1; PSA
Chromosome19
Locus Map19q13.41
Title Genetic variation in KLK2 and KLK3 is associated with concentrations of hK2 and PSA in serum and seminal plasma in young men .
Author Savblom C, Hallden C, Cronin AM, Sall T, Savage C, Vertosick EA, Klein RJ, Giwercman A and Lilja H.
Journal Clin. Chem. 60 (3), 490-499 (2014)
Title Measurement of serum PSA as a predictor of symptoms scored on the .
Author Lim CF and Buchan NC.
Journal N. Z. Med. J. 127 (1389), 17-24 (2014)
Title Detection of pelvic lymph node micrometastasis by real-time reverse transcriptase polymerase chain reaction in prostate cancer patients after hormonal therapy .
Author Liu DY, Xia WM, Tang Q, Wang J, Wang MW, Wang Y, Wang SJ, Ye YF, Zhou WL and Shao Y.
Journal J. Cancer Res. Clin. Oncol. 140 (2), 235-241 (2014)
Title Preoperative Gleason score, percent of positive prostate biopsies and PSA in predicting biochemical recurrence after radical prostatectomy .
Author Acimovic M, Dabic-Stankovic K, Pejcic T, Dzamic Z, Rafailovic D and Hadzi-Djokic J.
Journal J BUON 18 (4), 954-960 (2013)
Title Neoadjuvant hormonal therapy in prostate cancer - impact of PSA level before radiotherapy .
Author Dolezel M, Odrazka K, Vanasek J, Vaculikova M, Vlkova-Sefrova J, Jansa J, Macingova Z, Brodak M, Hartmann I and Melichar B.
Journal J BUON 18 (4), 949-953 (2013)
Title Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma .
Author Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC and Rosenfeld RG.
Journal J. Clin. Endocrinol. Metab. 75 (4), 1046-1053 (1992)
Title Functionally active protein C inhibitor/plasminogen activator inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at high concentrations in human seminal plasma and complexes with prostate-specific antigen .
Author Espana F, Gilabert J, Estelles A, Romeu A, Aznar J and Cabo A.
Journal Thromb. Res. 64 (3), 309-320 (1991)
Title Enzymatic activity of prostate-specific antigen and its reactions with extracellular serine proteinase inhibitors .
Author Christensson A, Laurell CB and Lilja H.
Journal Eur. J. Biochem. 194 (3), 755-763 (1990)
Title Molecular cloning of human prostate specific antigen cDNA .
Author Lundwall,A. and Lilja,H.
Journal FEBS Lett. 214 (2), 317-322 (1987)
Title Molecular cloning of human prostate specific antigen cDNA .
Author Lundwall,A. and Lilja,H.
Journal FEBS Lett. 214 (2), 317-322 (1987)
Title Human prostate-specific antigen: structural and functional similarity with serine proteases .
Author Watt,K.W., Lee,P.J., M'Timkulu,T., Chan,W.P. and Loor,R.
Journal Proc. Natl. Acad. Sci. U.S.A. 83 (10), 3166-3170 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.