• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_001648 Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA. ORF Sequence $227.94
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001648.2, 22208990
Length 1464 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA.
Product prostate-specific antigen isoform 1 preproprotein
Comment

Summary: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longest isoform (1) of this protein.

RefSeq NP_001639.1
CDS 42..827
Misc Feature(1)114..809
Misc Feature(2)114..116
Misc Feature(3)order(234..236,399..401,678..680)
Misc Feature(4)246..248
Misc Feature(5)273..275
Misc Feature(6)282..284
Misc Feature(7)546..548
Misc Feature(8)order(660..662,723..725,729..731)
Exon (1)1..87
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Exon (2)88..247
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Exon (3)248..534
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Exon (4)535..671
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Exon (5)672..1464
Gene:KLK3
Gene Synonym:APS; hK3; KLK2A1; PSA
Translation MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP SLYTKVVHYRKWIKDTIVANP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
25+dbSNP:
25+c, tdbSNP:199680464
50+c, tdbSNP:201712212
52+c, tdbSNP:111689449
73+c, tdbSNP:138400533
89+dbSNP:
89+c, tdbSNP:11573
90..91+c, tdbSNP:17849961
91+c, tdbSNP:181375335
94+c, tdbSNP:144347017
95+a, gdbSNP:1135766
111+c, tdbSNP:141576693
112+a, gdbSNP:147446084
122+a, cdbSNP:200846924
134+c, tdbSNP:139911579
135+c, tdbSNP:2271092
157+a, tdbSNP:200712655
158+a, gdbSNP:7252245
169+a, cdbSNP:140318583
175+a, gdbSNP:139560851
183+a, gdbSNP:149709822
187..188+, adbSNP:34953540
191+c, tdbSNP:144294681
194+c, tdbSNP:201710884
255+dbSNP:
255+a, gdbSNP:148892721
263+a, gdbSNP:150517791
270+c, tdbSNP:146422657
271+a, gdbSNP:140831892
278+c, tdbSNP:12946
279+c, tdbSNP:17849962
300+c, gdbSNP:138565183
341+c, gdbSNP:2739452
345+a, gdbSNP:61752561
411+c, tdbSNP:201390347
414+c, tdbSNP:61750343
431+c, tdbSNP:201110725
432+a, gdbSNP:182759459
435+g, tdbSNP:2003783
447+a, gdbSNP:149427770
488+a, gdbSNP:147547638
501+a, gdbSNP:138273452
519+a, tdbSNP:200126385
525+c, tdbSNP:112372888
530+a, gdbSNP:143868213
535+dbSNP:
535+c, tdbSNP:147249363
545+, adbSNP:111850120
566+c, tdbSNP:202206082
569+c, gdbSNP:148735869
577+c, tdbSNP:17632542
588+a, gdbSNP:150769385
629+c, gdbSNP:139172057
641+a, c, gdbSNP:1803129
646+g, tdbSNP:187449592
647+g, tdbSNP:191588971
649+c, tdbSNP:146528783
670+c, gdbSNP:61729813
675+dbSNP:
675+a, gdbSNP:151298874
704+c, tdbSNP:140564011
721+c, tdbSNP:138882542
722+a, gdbSNP:61736309
730+a, gdbSNP:200116262
740+a, gdbSNP:79245399
750+a, cdbSNP:144118163
752+c, tdbSNP:146297845
761+c, tdbSNP:45552633
767+a, gdbSNP:113126792
786+c, tdbSNP:1802720
790+a, gdbSNP:149376489
808+c, tdbSNP:144748315
813+a, gdbSNP:200006942
821+a, cdbSNP:148452103
842+c, tdbSNP:1058205
877+c, gdbSNP:112479005
886+c, gdbSNP:141498977
892+a, gdbSNP:1058274
904+a, tdbSNP:1803132
916+c, tdbSNP:1802722
918+c, tdbSNP:1141894
944+c, tdbSNP:116064912
951+a, gdbSNP:1802721
963+a, gdbSNP:116248649
964+a, cdbSNP:3180906
989+c, tdbSNP:16987771
1015+c, tdbSNP:1803138
1068+c, gdbSNP:190504941
1072+c, g, tdbSNP:12101
1105+a, gdbSNP:6998
1121+, gdbSNP:112363170
1133+a, cdbSNP:16987775
1209+c, tdbSNP:1803136
1227+a, gdbSNP:1803135
1240+a, gdbSNP:193123776
1247+c, tdbSNP:1803134
1271+a, gdbSNP:12040
1287+a, gdbSNP:61269009
1324+c, tdbSNP:1803133
1331+c, tdbSNP:11554029
1342+a, gdbSNP:12863
1361+a, gdbSNP:1803137
1366+c, tdbSNP:11554028
1416+c, tdbSNP:11554027
Gene SymbolKLK3
Gene SynonymAPS; hK3; KLK2A1; PSA
Chromosome19
Locus Map19q13.41
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001030047 Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 3, mRNA. Full Length $552.74
ORF Sequence $207.93
NM_001030048 Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 4, mRNA. Full Length $387.15
ORF Sequence $190.53
NM_001648 Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA. Full Length $424.56
ORF Sequence $227.94
Title Further replication studies of the EVE Consortium meta-analysis identifies 2 asthma risk loci in European Americans .
Author Myers,R.A., Himes,B.E., Gignoux,C.R., Yang,J.J., Gauderman,W.J., Rebordosa,C., Xie,J., Torgerson,D.G., Levin,A.M., Baurley,J., Graves,P.E., Mathias,R.A., Romieu,I., Roth,L.A., Conti,D., Avila,L., Eng,C., Vora,H., LeNoir,M.A., Soto-Quiros,M., Liu,J., Celedon,J.C., Farber,H.J., Kumar,R., Avila,P.C., Meade,K., Serebrisky,D., Thyne,S., Rodriguez-Cintron,W., Rodriguez-Santana,J.R., Borrell,L.N., Lemanske,R.F. Jr., Bleecker,E.R., Meyers,D.A., London,S.J., Barnes,K.C., Raby,B.A., Martinez,F.D., Gilliland,F.D., Williams,L.K., Burchard,E.G., Weiss,S.T., Nicolae,D.L. and Ober,C.
Journal J. Allergy Clin. Immunol. 130 (6), 1294-1301 (2012)
Title Obesity, prostate-specific antigen nadir, and biochemical recurrence after radical prostatectomy: biology or technique? Results from the SEARCH database .
Author Ho,T., Gerber,L., Aronson,W.J., Terris,M.K., Presti,J.C., Kane,C.J., Amling,C.L. and Freedland,S.J.
Journal Eur. Urol. 62 (5), 910-916 (2012)
Title Effectiveness of the combined evaluation of KLK3 genetics and free-to-total prostate specific antigen ratio for prostate cancer diagnosis .
Author Zambon,C.F., Prayer-Galetti,T., Basso,D., Padoan,A., Rossi,E., Secco,S., Pelloso,M., Fogar,P., Navaglia,F., Moz,S., Zattoni,F. and Plebani,M.
Journal J. Urol. 188 (4), 1124-1130 (2012)
Title Genomic deletion of PTEN is associated with tumor progression and early PSA recurrence in ERG fusion-positive and fusion-negative prostate cancer .
Author Krohn,A., Diedler,T., Burkhardt,L., Mayer,P.S., De Silva,C., Meyer-Kornblum,M., Kotschau,D., Tennstedt,P., Huang,J., Gerhauser,C., Mader,M., Kurtz,S., Sirma,H., Saad,F., Steuber,T., Graefen,M., Plass,C., Sauter,G., Simon,R., Minner,S. and Schlomm,T.
Journal Am. J. Pathol. 181 (2), 401-412 (2012)
Title Relationship between dietary factors and prostate-specific antigen in healthy men .
Author Ohwaki,K., Endo,F., Kachi,Y., Hattori,K., Muraishi,O., Nishikitani,M. and Yano,E.
Journal Urol. Int. 89 (3), 270-274 (2012)
Title Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma .
Author Cohen,P., Graves,H.C., Peehl,D.M., Kamarei,M., Giudice,L.C. and Rosenfeld,R.G.
Journal J. Clin. Endocrinol. Metab. 75 (4), 1046-1053 (1992)
Title Functionally active protein C inhibitor/plasminogen activator inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at high concentrations in human seminal plasma and complexes with prostate-specific antigen .
Author Espana,F., Gilabert,J., Estelles,A., Romeu,A., Aznar,J. and Cabo,A.
Journal Thromb. Res. 64 (3), 309-320 (1991)
Title Enzymatic activity of prostate-specific antigen and its reactions with extracellular serine proteinase inhibitors .
Author Christensson,A., Laurell,C.B. and Lilja,H.
Journal Eur. J. Biochem. 194 (3), 755-763 (1990)
Title Molecular cloning of human prostate specific antigen cDNA .
Author Lundwall,A. and Lilja,H.
Journal FEBS Lett. 214 (2), 317-322 (1987)
Title Molecular cloning of human prostate specific antigen cDNA .
Author Lundwall,A. and Lilja,H.
Journal FEBS Lett. 214 (2), 317-322 (1987)
Title Human prostate-specific antigen: structural and functional similarity with serine proteases .
Author Watt,K.W., Lee,P.J., M'Timkulu,T., Chan,W.P. and Loor,R.
Journal Proc. Natl. Acad. Sci. U.S.A. 83 (10), 3166-3170 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878