• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001648 Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA. Full Lenth $424.56
ORF Sequence $227.94


RefSeq Version NM_001648.2, 22208990
Length 1464 bp
Structure linear
Update Date 01-MAY-2011
Organism Homo sapiens (human)
Definition Homo sapiens kallikrein-related peptidase 3 (KLK3), transcript variant 1, mRNA.
Product prostate-specific antigen isoform 1 preproprotein
Comment

Summary: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq].


Transcript Variant: This variant (1) encodes the longest isoform (1) of this protein.

RefSeq NP_001639.1
CDS 42..827
Exon (1)1..87
Exon (2)1..87
Exon (3)88..247
Exon (4)248..534
Exon (5)535..671
Exon (6)672..1464
Translation MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP SLYTKVVHYRKWIKDTIVANP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
52+c, tdbSNP:111689449
89+c, tdbSNP:11573
90..91+c, tdbSNP:17849961
95+a, gdbSNP:1135766
complement(135)-t, cdbSNP:2271092
158+a, gdbSNP:7252245
187..188+, adbSNP:34953540
278+c, tdbSNP:12946
279+c, tdbSNP:17849962
341+c, gdbSNP:2739452
345+a, gdbSNP:61752561
414+c, tdbSNP:61750343
complement(435)-t, gdbSNP:2003783
525+c, tdbSNP:112372888
548+, adbSNP:111850120
577+c, tdbSNP:17632542
641+a, gdbSNP:1803129
670+c, gdbSNP:61729813
722+a, gdbSNP:61736309
740+a, gdbSNP:79245399
761+c, tdbSNP:45552633
767+a, gdbSNP:113126792
786+c, tdbSNP:1802720
842+c, tdbSNP:1058205
877+c, gdbSNP:112479005
892+a, gdbSNP:1058274
904+a, tdbSNP:1803132
916+c, tdbSNP:1802722
918+c, tdbSNP:1141894
944+c, tdbSNP:116064912
951+a, gdbSNP:1802721
963+a, gdbSNP:116248649
964+a, cdbSNP:3180906
989+c, tdbSNP:16987771
1015+c, tdbSNP:1803138
1072+c, tdbSNP:12101
1105+a, gdbSNP:6998
1125+, gdbSNP:112363170
1133+a, cdbSNP:16987775
1209+c, tdbSNP:1803136
1227+a, gdbSNP:1803135
1247+c, tdbSNP:1803134
1271+a, gdbSNP:12040
1287+a, gdbSNP:61269009
1324+c, tdbSNP:1803133
complement(1331)-t, cdbSNP:11554029
1342+a, gdbSNP:12863
1361+a, gdbSNP:1803137
complement(1366)-t, cdbSNP:11554028
1416+c, tdbSNP:11554027
Gene SymbolKLK3
Gene SynonymAPS; hK3; KLK2A1; PSA
Chromosome19
Locus Map19q13.41
All Transcripts NM_001648 , NM_001030047 , NM_001030048 , NM_001030050
Title miR-99 family of MicroRNAs suppresses the expression of prostate-specific antigen and prostate cancer cell proliferation .
Author Sun,D., Lee,Y.S., Malhotra,A., Kim,H.K., Matecic,M., Evans,C., Jensen,R.V., Moskaluk,C.A. and Dutta,A.
Journal Cancer Res. 71 (4), 1313-1324 (2011)
Title What is the true number needed to screen and treat to save a life with prostate-specific antigen testing? .
Author Loeb,S., Vonesh,E.F., Metter,E.J., Carter,H.B., Gann,P.H. and Catalona,W.J.
Journal J. Clin. Oncol. 29 (4), 464-467 (2011)
Title Validation of genome-wide prostate cancer associations in men of African descent .
Author Chang,B.L., Spangler,E., Gallagher,S., Haiman,C.A., Henderson,B., Isaacs,W., Benford,M.L., Kidd,L.R., Cooney,K., Strom,S., Ingles,S.A., Stern,M.C., Corral,R., Joshi,A.D., Xu,J., Giri,V.N., Rybicki,B., Neslund-Dudas,C., Kibel,A.S., Thompson,I.M., Leach,R.J., Ostrander,E.A., Stanford,J.L., Witte,J., Casey,G., Eeles,R., Hsing,A.W., Chanock,S., Hu,J.J., John,E.M., Park,J., Stefflova,K., Zeigler-Johnson,C. and Rebbeck,T.R.
Journal Cancer Epidemiol. Biomarkers Prev. 20 (1), 23-32 (2011)
Title Genetic correction of PSA values using sequence variants associated with PSA levels .
Author Gudmundsson,J., Besenbacher,S., Sulem,P., Gudbjartsson,D.F., Olafsson,I., Arinbjarnarson,S., Agnarsson,B.A., Benediktsdottir,K.R., Isaksson,H.J., Kostic,J.P., Gudjonsson,S.A., Stacey,S.N., Gylfason,A., Sigurdsson,A., Holm,H., Bjornsdottir,U.S., Eyjolfsson,G.I., Navarrete,S., Fuertes,F., Garcia-Prats,M.D., Polo,E., Checherita,I.A., Jinga,M., Badea,P., Aben,K.K., Schalken,J.A., van Oort,I.M., Sweep,F.C., Helfand,B.T., Davis,M., Donovan,J.L., Hamdy,F.C., Kristjansson,K., Gulcher,J.R., Masson,G., Kong,A., Catalona,W.J., Mayordomo,J.I., Geirsson,G., Einarsson,G.V., Barkardottir,R.B., Jonsson,E., Jinga,V., Mates,D., Kiemeney,L.A., Neal,D.E., Thorsteinsdottir,U., Rafnar,T. and Stefansson,K.
Journal Sci Transl Med 2 (62), 62RA92 (2010)
Title Co-expression and impact of prostate specific membrane antigen and prostate specific antigen in prostatic pathologies .
Author Ben Jemaa,A., Bouraoui,Y., Sallami,S., Banasr,A., Ben Rais,N., Ouertani,L., Nouira,Y., Horchani,A. and Oueslati,R.
Journal J. Exp. Clin. Cancer Res. 29, 171 (2010)
Title Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma .
Author Cohen,P., Graves,H.C., Peehl,D.M., Kamarei,M., Giudice,L.C. and Rosenfeld,R.G.
Journal J. Clin. Endocrinol. Metab. 75 (4), 1046-1053 (1992)
Title Enzymatic activity of prostate-specific antigen and its reactions with extracellular serine proteinase inhibitors .
Author Christensson,A., Laurell,C.B. and Lilja,H.
Journal Eur. J. Biochem. 194 (3), 755-763 (1990)
Title Sequence of a cDNA clone encompassing the complete mature human prostate specific antigen (PSA) and an unspliced leader sequence .
Author Schulz,P., Stucka,R., Feldmann,H., Combriato,G., Klobeck,H.G. and Fittler,F.
Journal Nucleic Acids Res. 16 (13), 6226 (1988)
Title Molecular cloning of human prostate specific antigen cDNA .
Author Lundwall,A. and Lilja,H.
Journal FEBS Lett. 214 (2), 317-322 (1987)
Title Molecular cloning of human prostate specific antigen cDNA .
Author Lundwall,A. and Lilja,H.
Journal FEBS Lett. 214 (2), 317-322 (1987)
Title Human prostate-specific antigen: structural and functional similarity with serine proteases .
Author Watt,K.W., Lee,P.J., M'Timkulu,T., Chan,W.P. and Loor,R.
Journal Proc. Natl. Acad. Sci. U.S.A. 83 (10), 3166-3170 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878