• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ADP-ribosylation factor 5 (ARF5), mRNA.


RefSeq Accession Definition Services Price Order
NM_001662 Homo sapiens ADP-ribosylation factor 5 (ARF5), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001662.3, 313760590
Length 1096 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ADP-ribosylation factor 5 (ARF5), mRNA.
Product ADP-ribosylation factor 5
Comment

Summary: This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010].

RefSeq NP_001653.1
CDS 148..690
Misc Feature(1)184..>618
Misc Feature(2)184..>618
Misc Feature(3)199..675
Misc Feature(4)217..240
Misc Feature(5)order(223..243,523..528,532..534,622..630)
Misc Feature(6)order(223..228,238..240,250..252,286..309,373..375,
Misc Feature(7)253..300
Misc Feature(8)order(289..303,316..318,346..348,358..360,364..366,
Misc Feature(9)289..291
Misc Feature(10)order(292..300,364..366,385..387)
Misc Feature(11)298..345
Misc Feature(12)346..357
Misc Feature(13)352..405
Misc Feature(14)523..534
Misc Feature(15)622..630
Exon (1)1..214
Gene:ARF5
Gene Synonym:ARF5
Exon (2)215..295
Gene:ARF5
Gene Synonym:ARF5
Exon (3)296..405
Gene:ARF5
Gene Synonym:ARF5
Exon (4)406..477
Gene:ARF5
Gene Synonym:ARF5
Exon (5)478..603
Gene:ARF5
Gene Synonym:ARF5
Exon (6)604..1096
Gene:ARF5
Gene Synonym:ARF5
Translation MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAV LLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
64+dbSNP:
64+a, tdbSNP:180872431
65+a, gdbSNP:144086218
203+g, tdbSNP:202016109
263+dbSNP:
263+g, tdbSNP:1803150
366+dbSNP:
366+a, gdbSNP:138066010
420+dbSNP:
420+a, gdbSNP:149540717
437+a, gdbSNP:144009854
544+dbSNP:
544+a, gdbSNP:201108741
588+c, tdbSNP:34457964
639+dbSNP:
639+a, cdbSNP:77229708
672+c, tdbSNP:142827438
718+c, g, tdbSNP:11539552
725+c, gdbSNP:2301566
765+c, tdbSNP:192153447
772+c, tdbSNP:115245503
861+a, gdbSNP:3190668
898+c, tdbSNP:113896519
973+c, tdbSNP:1803149
1028+a, gdbSNP:11539551
1094+c, tdbSNP:184197972
Gene SymbolARF5
Gene SynonymARF5
Chromosome7
Locus Map7q31.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001662 Homo sapiens ADP-ribosylation factor 5 (ARF5), mRNA. Full Length $317.84
ORF Sequence $159.00
Title BRAG2/GEP100/IQSec1 interacts with clathrin and regulates alpha5beta1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5) .
Author Moravec,R., Conger,K.K., D'Souza,R., Allison,A.B. and Casanova,J.E.
Journal J. Biol. Chem. 287 (37), 31138-31147 (2012)
Title ARAP1 regulates the ring size of circular dorsal ruffles through Arf1 and Arf5 .
Author Hasegawa,J., Tsujita,K., Takenawa,T. and Itoh,T.
Journal Mol. Biol. Cell 23 (13), 2481-2489 (2012)
Title Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration .
Author Martins-de-Souza,D., Guest,P.C., Mann,D.M., Roeber,S., Rahmoune,H., Bauder,C., Kretzschmar,H., Volk,B., Baborie,A. and Bahn,S.
Journal J. Proteome Res. 11 (4), 2533-2543 (2012)
Title Class II ADP-ribosylation factors are required for efficient secretion of dengue viruses .
Author Kudelko,M., Brault,J.B., Kwok,K., Li,M.Y., Pardigon,N., Peiris,J.S., Bruzzone,R., Despres,P., Nal,B. and Wang,P.G.
Journal J. Biol. Chem. 287 (1), 767-777 (2012)
Title GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis .
Author Takashima,K., Saitoh,A., Hirose,S., Nakai,W., Kondo,Y., Takasu,Y., Kakeya,H., Shin,H.W. and Nakayama,K.
Journal Cell Struct. Funct. 36 (2), 223-235 (2011)
Title Coated vesicle assembly in the Golgi requires only coatomer and ARF proteins from the cytosol .
Author Orcl,L., Palmer,D.J., Amherdt,M. and Rothman,J.E.
Journal Nature 364 (6439), 732-734 (1993)
Title Two distinct populations of ARF bound to Golgi membranes .
Author Helms,J.B., Palmer,D.J. and Rothman,J.E.
Journal J. Cell Biol. 121 (4), 751-760 (1993)
Title Human and Giardia ADP-ribosylation factors (ARFs) complement ARF function in Saccharomyces cerevisiae .
Author Lee,F.J., Moss,J. and Vaughan,M.
Journal J. Biol. Chem. 267 (34), 24441-24445 (1992)
Title Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells .
Author Tsuchiya,M., Price,S.R., Tsai,S.C., Moss,J. and Vaughan,M.
Journal J. Biol. Chem. 266 (5), 2772-2777 (1991)
Title ADP-ribosylation factor is functionally and physically associated with the Golgi complex .
Author Stearns,T., Willingham,M.C., Botstein,D. and Kahn,R.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (3), 1238-1242 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878