• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ADP-ribosylation factor 5 (ARF5), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu01577 Homo sapiens ADP-ribosylation factor 5 (ARF5), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu01577C Homo sapiens ADP-ribosylation factor 5 (ARF5), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001662.3, 313760590
Length 543 bp
Structure linear
Update Date 20-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens ADP-ribosylation factor 5 (ARF5), mRNA.
Product ADP-ribosylation factor 5
Comment

Summary: This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010].

RefSeq NP_001653.1
CDS 148..690
Misc Feature(1)184..>618
Misc Feature(2)184..>618
Misc Feature(3)199..675
Misc Feature(4)217..240
Misc Feature(5)order(223..243,523..528,532..534,622..630)
Misc Feature(6)order(223..228,238..240,250..252,286..309,373..375,
Misc Feature(7)253..300
Misc Feature(8)order(289..303,316..318,346..348,358..360,364..366,
Misc Feature(9)289..291
Misc Feature(10)order(292..300,364..366,385..387)
Misc Feature(11)298..345
Misc Feature(12)346..357
Misc Feature(13)352..405
Misc Feature(14)523..534
Misc Feature(15)622..630
Exon (1)1..214
Gene:ARF5
Gene Synonym:ARF5
Exon (2)215..295
Gene:ARF5
Gene Synonym:ARF5
Exon (3)296..405
Gene:ARF5
Gene Synonym:ARF5
Exon (4)406..477
Gene:ARF5
Gene Synonym:ARF5
Exon (5)478..603
Gene:ARF5
Gene Synonym:ARF5
Exon (6)604..1096
Gene:ARF5
Gene Synonym:ARF5
Translation MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAV LLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
64+dbSNP:
64+a, tdbSNP:180872431
65+a, gdbSNP:144086218
203+g, tdbSNP:202016109
263+dbSNP:
263+g, tdbSNP:1803150
366+dbSNP:
366+a, gdbSNP:138066010
420+dbSNP:
420+a, gdbSNP:149540717
436+c, tdbSNP:367999369
437+a, gdbSNP:144009854
544+dbSNP:
544+a, gdbSNP:201108741
570+c, tdbSNP:376366932
582+a, gdbSNP:369276987
588+c, tdbSNP:34457964
639+dbSNP:
639+a, cdbSNP:77229708
672+c, tdbSNP:142827438
694+a, gdbSNP:371181234
703+a, gdbSNP:374060875
709+c, gdbSNP:376927315
complement(718)-t, g, cdbSNP:11539552
725+c, gdbSNP:2301566
740+a, gdbSNP:368139645
765+c, tdbSNP:192153447
772+c, tdbSNP:115245503
861+a, gdbSNP:3190668
898+c, tdbSNP:113896519
982..983+, tdbSNP:377612947
1028+a, gdbSNP:11539551
1094+c, tdbSNP:184197972
Gene SymbolARF5
Gene SynonymARF5
Chromosome7
Locus Map7q31.3
Title Genome-wide association study in a Chinese population identifies a susceptibility locus for type 2 diabetes at 7q32 near PAX4 .
Author Ma RC, Hu C, Tam CH, Zhang R, Kwan P, Leung TF, Thomas GN, Go MJ, Hara K, Sim X, Ho JS, Wang C, Li H, Lu L, Wang Y, Li JW, Wang Y, Lam VK, Wang J, Yu W, Kim YJ, Ng DP, Fujita H, Panoutsopoulou K, Day-Williams AG, Lee HM, Ng AC, Fang YJ, Kong AP, Jiang F, Ma X, Hou X, Tang S, Lu J, Yamauchi T, Tsui SK, Woo J, Leung PC, Zhang X, Tang NL, Sy HY, Liu J, Wong TY, Lee JY, Maeda S, Xu G, Cherny SS, Chan TF, Ng MC, Xiang K, Morris AP, Keildson S, Hu R, Ji L, Lin X, Cho YS, Kadowaki T, Tai ES, Zeggini E, McCarthy MI, Hon KL, Baum L, Tomlinson B, So WY, Bao Y, Chan JC and Jia W.
Journal Diabetologia 56 (6), 1291-1305 (2013)
Title BRAG2/GEP100/IQSec1 interacts with clathrin and regulates alpha5beta1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5) .
Author Moravec R, Conger KK, D'Souza R, Allison AB and Casanova JE.
Journal J. Biol. Chem. 287 (37), 31138-31147 (2012)
Title ARAP1 regulates the ring size of circular dorsal ruffles through Arf1 and Arf5 .
Author Hasegawa J, Tsujita K, Takenawa T and Itoh T.
Journal Mol. Biol. Cell 23 (13), 2481-2489 (2012)
Title Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration .
Author Martins-de-Souza D, Guest PC, Mann DM, Roeber S, Rahmoune H, Bauder C, Kretzschmar H, Volk B, Baborie A and Bahn S.
Journal J. Proteome Res. 11 (4), 2533-2543 (2012)
Title GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis .
Author Takashima K, Saitoh A, Hirose S, Nakai W, Kondo Y, Takasu Y, Kakeya H, Shin HW and Nakayama K.
Journal Cell Struct. Funct. 36 (2), 223-235 (2011)
Title Coated vesicle assembly in the Golgi requires only coatomer and ARF proteins from the cytosol .
Author Orcl L, Palmer DJ, Amherdt M and Rothman JE.
Journal Nature 364 (6439), 732-734 (1993)
Title Two distinct populations of ARF bound to Golgi membranes .
Author Helms JB, Palmer DJ and Rothman JE.
Journal J. Cell Biol. 121 (4), 751-760 (1993)
Title Human and Giardia ADP-ribosylation factors (ARFs) complement ARF function in Saccharomyces cerevisiae .
Author Lee FJ, Moss J and Vaughan M.
Journal J. Biol. Chem. 267 (34), 24441-24445 (1992)
Title Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells .
Author Tsuchiya M, Price SR, Tsai SC, Moss J and Vaughan M.
Journal J. Biol. Chem. 266 (5), 2772-2777 (1991)
Title ADP-ribosylation factor is functionally and physically associated with the Golgi complex .
Author Stearns T, Willingham MC, Botstein D and Kahn RA.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (3), 1238-1242 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.