• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), mRNA.


RefSeq Accession Definition Services Price Order
NM_001677 Homo sapiens ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), mRNA. ORF Sequence $264.48
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001677.3, 49574487
Length 2212 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), mRNA.
Product sodium/potassium-transporting ATPase subunit beta-1
Comment

Summary: The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. [provided by RefSeq, Mar 2010].

RefSeq NP_001668.1
CDS 122..1033
Misc Feature(1)107..109
Misc Feature(2)107..109
Misc Feature(3)122..1030
Misc Feature(4)122..1030
Misc Feature(5)224..307
Exon (1)1..218
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (2)219..347
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (3)348..503
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (4)504..688
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (5)689..769
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (6)770..2200
Gene:ATP1B1
Gene Synonym:ATP1B
Translation MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT ISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD MIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKL NRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE VKS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
121+a, cdbSNP:144750047
128+c, gdbSNP:11545852
190+a, gdbSNP:147872554
239+dbSNP:
239+a, gdbSNP:147107209
258+c, tdbSNP:199629231
259+c, gdbSNP:201777374
284+a, c, tdbSNP:11545848
287+a, gdbSNP:11545849
343+a, gdbSNP:144621395
409+dbSNP:
409+a, gdbSNP:149479006
426+a, tdbSNP:199737584
442+a, gdbSNP:61742560
502+c, tdbSNP:146260113
519+dbSNP:
519+c, tdbSNP:141812161
523+a, gdbSNP:201640017
548+c, tdbSNP:80176946
553+a, tdbSNP:76396666
583+a, gdbSNP:72706956
594+a, gdbSNP:139587518
602+c, gdbSNP:200684046
643+a, gdbSNP:144685960
661+c, tdbSNP:145356218
721+a, cdbSNP:61803314
751+c, tdbSNP:151290623
853+dbSNP:
853+c, gdbSNP:140674456
941+a, gdbSNP:140309868
955+a, gdbSNP:143722809
958+c, tdbSNP:145238933
1010+a, gdbSNP:144160193
1054+a, cdbSNP:14824
1300+a, gdbSNP:12079745
1403+a, gdbSNP:111349429
1425+g, tdbSNP:12565299
1470+c, tdbSNP:140526593
1497..1498+, tdbSNP:34447553
1498..1499+, tdbSNP:56167655
1508..1509+, gdbSNP:202172887
1509..1510+, gdbSNP:199593766
1509+g, tdbSNP:200351363
1512+g, tdbSNP:1779795
1513+a, g, tdbSNP:1779796
1520+g, tdbSNP:184990529
1521+g, tdbSNP:4656649
1529..1530+, tctdbSNP:142552777
1535+c, gdbSNP:192644106
1552+c, tdbSNP:142647779
1605+a, tdbSNP:1061319
1611+a, tdbSNP:1061321
1699+g, tdbSNP:4656650
1703+c, gdbSNP:184534924
1738+c, gdbSNP:115129472
1766+c, tdbSNP:9765
1797+a, gdbSNP:151010602
2044+a, gdbSNP:112941951
2071+a, gdbSNP:150136713
2087+a, gdbSNP:138857215
2128+g, tdbSNP:12091
2140+c, tdbSNP:113442279
2175+c, g, tdbSNP:1138486
2195+a, cdbSNP:3180378
Gene SymbolATP1B1
Gene SynonymATP1B
Chromosome1
Locus Map1q24
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001677 Homo sapiens ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), mRNA. Full Length $641.48
ORF Sequence $264.48
Title Regulation of Na(+)/K(+)-ATPase by nuclear respiratory factor 1: implication in the tight coupling of neuronal activity, energy generation, and energy consumption .
Author Johar,K., Priya,A. and Wong-Riley,M.T.
Journal J. Biol. Chem. 287 (48), 40381-40390 (2012)
Title Protein kinase A (PKA) phosphorylation of Na+/K+-ATPase opens intracellular C-terminal water pathway leading to third Na+-binding site in molecular dynamics simulations .
Author Poulsen,H., Nissen,P., Mouritsen,O.G. and Khandelia,H.
Journal J. Biol. Chem. 287 (19), 15959-15965 (2012)
Title Association of ATP1B1, RGS5 and SELE polymorphisms with hypertension and blood pressure in African-Americans .
Author Faruque,M.U., Chen,G., Doumatey,A., Huang,H., Zhou,J., Dunston,G.M., Rotimi,C.N. and Adeyemo,A.A.
Journal J. Hypertens. 29 (10), 1906-1912 (2011)
Title Epithelial junctions depend on intercellular trans-interactions between the Na,K-ATPase beta(1) subunits .
Author Tokhtaeva,E., Sachs,G., Souda,P., Bassilian,S., Whitelegge,J.P., Shoshani,L. and Vagin,O.
Journal J. Biol. Chem. 286 (29), 25801-25812 (2011)
Title Phospholemman (FXYD1) raises the affinity of the human alpha1beta1 isoform of Na,K-ATPase for Na ions .
Author Cirri,E., Katz,A., Mishra,N.K., Belogus,T., Lifshitz,Y., Garty,H., Karlish,S.J. and Apell,H.J.
Journal Biochemistry 50 (18), 3736-3748 (2011)
Title Molecular genetics of Na,K-ATPase .
Author Lingrel,J.B., Orlowski,J., Shull,M.M. and Price,E.M.
Journal Prog. Nucleic Acid Res. Mol. Biol. 38, 37-89 (1990)
Title Human Na+,K+-ATPase genes. Beta-subunit gene family contains at least one gene and one pseudogene .
Author Ushkaryov,Yu.A., Monastyrskaya,G.S., Broude,N.E., Nikiforova,N.N., Bessarab,D.A., Orlova,M.Yu., Petrukhin,K.E., Modyanov,N.N. and Sverdlov,E.D.
Journal FEBS Lett. 257 (2), 439-442 (1989)
Title Characterization of two genes for the human Na,K-ATPase beta subunit .
Author Lane,L.K., Shull,M.M., Whitmer,K.R. and Lingrel,J.B.
Journal Genomics 5 (3), 445-453 (1989)
Title Identification of a putative isoform of the Na,K-ATPase beta subunit. Primary structure and tissue-specific expression .
Author Martin-Vasallo,P., Dackowski,W., Emanuel,J.R. and Levenson,R.
Journal J. Biol. Chem. 264 (8), 4613-4618 (1989)
Title Chromosomal localization of human Na+, K+-ATPase alpha- and beta-subunit genes .
Author Yang-Feng,T.L., Schneider,J.W., Lindgren,V., Shull,M.M., Benz,E.J. Jr., Lingrel,J.B. and Francke,U.
Journal Genomics 2 (2), 128-138 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878