• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001677 Homo sapiens ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_001677.3, 49574487
Length 2212 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), mRNA.
Product sodium/potassium-transporting ATPase subunit beta-1
Comment

Summary: The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. [provided by RefSeq, Mar 2010].

RefSeq NP_001668.1
CDS 122..1033
Misc Feature(1)107..109
Misc Feature(2)122..1030
Misc Feature(3)122..1030
Misc Feature(4)224..307
Misc Feature(5)692..1030
Exon (1)1..218
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (2)219..347
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (3)348..503
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (4)504..688
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (5)689..769
Gene:ATP1B1
Gene Synonym:ATP1B
Exon (6)770..2200
Gene:ATP1B1
Gene Synonym:ATP1B
Translation MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT ISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD MIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKL NRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE VKS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
76+dbSNP:
76+a, cdbSNP:368576961
121+a, cdbSNP:144750047
128+c, gdbSNP:11545852
190+a, gdbSNP:147872554
239+dbSNP:
239+a, gdbSNP:147107209
258+c, tdbSNP:199629231
259+c, gdbSNP:201777374
284+a, c, tdbSNP:11545848
287+a, gdbSNP:11545849
339+c, tdbSNP:377341777
343+a, gdbSNP:144621395
345+c, tdbSNP:372183032
409+dbSNP:
409+a, gdbSNP:149479006
421+a, gdbSNP:367624941
426+a, tdbSNP:199737584
442+a, gdbSNP:61742560
469+a, cdbSNP:372210037
502+c, tdbSNP:146260113
519+dbSNP:
519+c, tdbSNP:141812161
523+a, gdbSNP:201640017
548+c, tdbSNP:80176946
553+a, tdbSNP:76396666
583+a, gdbSNP:72706956
586+g, tdbSNP:376981775
591+c, gdbSNP:370098063
594+a, gdbSNP:139587518
602+c, gdbSNP:200684046
637+a, cdbSNP:377019756
643+a, gdbSNP:144685960
650+a, tdbSNP:368950948
653+a, gdbSNP:373429168
661+c, tdbSNP:145356218
692+dbSNP:
692+c, tdbSNP:267598155
704+a, tdbSNP:371385406
721+a, cdbSNP:61803314
751+c, tdbSNP:151290623
752+a, gdbSNP:368014776
853+dbSNP:
853+a, gdbSNP:140674456
915+a, gdbSNP:369488918
937+c, tdbSNP:377755946
941+a, gdbSNP:140309868
955+a, gdbSNP:143722809
958+c, tdbSNP:145238933
1010+a, gdbSNP:144160193
1054+a, cdbSNP:14824
1058+a, gdbSNP:372894803
1074..1077+, aaaadbSNP:376402959
1218..1221+, tattdbSNP:374342138
1300+a, gdbSNP:12079745
1340+a, gdbSNP:367551064
1403+a, gdbSNP:111349429
1425+g, tdbSNP:12565299
1425+g, tdbSNP:386524952
1470+c, tdbSNP:140526593
1497..1498+, tdbSNP:34447553
1498..1499+, tdbSNP:56167655
1508..1509+, gdbSNP:202172887
1509..1510+, gdbSNP:199593766
1509+g, tdbSNP:200351363
1512+g, tdbSNP:1779795
1513+a, g, tdbSNP:1779796
complement(1520)-t, gdbSNP:184990529
1521+g, tdbSNP:4656649
1529..1530+, tctdbSNP:142552777
1535+c, gdbSNP:192644106
1552+c, tdbSNP:142647779
1605+a, tdbSNP:1061319
1611+a, tdbSNP:1061321
1627+c, tdbSNP:368906439
1699+g, tdbSNP:4656650
1703+c, gdbSNP:184534924
1729+a, cdbSNP:372178427
1738+c, gdbSNP:115129472
1763+a, gdbSNP:376994787
1766+c, tdbSNP:9765
1797+a, gdbSNP:151010602
1958..1959+, ttadbSNP:368530537
2044+a, gdbSNP:112941951
2071+a, gdbSNP:150136713
2087+a, gdbSNP:138857215
2128+g, tdbSNP:12091
2140+c, tdbSNP:113442279
2175+c, g, tdbSNP:1138486
complement(2195)-c, adbSNP:3180378
Gene SymbolATP1B1
Gene SynonymATP1B
Chromosome1
Locus Map1q24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001677 Homo sapiens ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1), mRNA. In-stock $348.00 $299.00 10
Title Na(+)/K(+)-ATPase expression changes in the rabbit lacrimal glands during pregnancy .
Author Huang J, Lu M and Ding C.
Journal Curr. Eye Res. 38 (1), 18-26 (2013)
Title Impact of ancestry and common genetic variants on QT interval in African Americans .
Author Smith JG, Avery CL, Evans DS, Nalls MA, Meng YA, Smith EN, Palmer C, Tanaka T, Mehra R, Butler AM, Young T, Buxbaum SG, Kerr KF, Berenson GS, Schnabel RB, Li G, Ellinor PT, Magnani JW, Chen W, Bis JC, Curb JD, Hsueh WC, Rotter JI, Liu Y, Newman AB, Limacher MC, North KE, Reiner AP, Quibrera PM, Schork NJ, Singleton AB, Psaty BM, Soliman EZ, Solomon AJ, Srinivasan SR, Alonso A, Wallace R, Redline S, Zhang ZM, Post WS, Zonderman AB, Taylor HA, Murray SS, Ferrucci L, Arking DE, Evans MK, Fox ER, Sotoodehnia N, Heckbert SR, Whitsel EA and Newton-Cheh C.
Journal Circ Cardiovasc Genet 5 (6), 647-655 (2012)
Title Regulation of Na(+)/K(+)-ATPase by nuclear respiratory factor 1: implication in the tight coupling of neuronal activity, energy generation, and energy consumption .
Author Johar K, Priya A and Wong-Riley MT.
Journal J. Biol. Chem. 287 (48), 40381-40390 (2012)
Title Protein kinase A (PKA) phosphorylation of Na+/K+-ATPase opens intracellular C-terminal water pathway leading to third Na+-binding site in molecular dynamics simulations .
Author Poulsen H, Nissen P, Mouritsen OG and Khandelia H.
Journal J. Biol. Chem. 287 (19), 15959-15965 (2012)
Title Association of ATP1B1, RGS5 and SELE polymorphisms with hypertension and blood pressure in African-Americans .
Author Faruque MU, Chen G, Doumatey A, Huang H, Zhou J, Dunston GM, Rotimi
Journal J. Hypertens. 29 (10), 1906-1912 (2011)
Title Molecular genetics of Na,K-ATPase .
Author Lingrel JB, Orlowski J, Shull MM and Price EM.
Journal Prog. Nucleic Acid Res. Mol. Biol. 38, 37-89 (1990)
Title Human Na+,K+-ATPase genes. Beta-subunit gene family contains at least one gene and one pseudogene .
Author Ushkaryov YuA, Monastyrskaya GS, Broude NE, Nikiforova NN, Bessarab DA, Orlova MYu, Petrukhin KE, Modyanov NN and Sverdlov ED.
Journal FEBS Lett. 257 (2), 439-442 (1989)
Title Characterization of two genes for the human Na,K-ATPase beta subunit .
Author Lane LK, Shull MM, Whitmer KR and Lingrel JB.
Journal Genomics 5 (3), 445-453 (1989)
Title Identification of a putative isoform of the Na,K-ATPase beta subunit. Primary structure and tissue-specific expression .
Author Martin-Vasallo P, Dackowski W, Emanuel JR and Levenson R.
Journal J. Biol. Chem. 264 (8), 4613-4618 (1989)
Title Chromosomal localization of human Na+, K+-ATPase alpha- and beta-subunit genes .
Author Yang-Feng TL, Schneider JW, Lindgren V, Shull MM, Benz EJ Jr, Lingrel JB and Francke U.
Journal Genomics 2 (2), 128-138 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.