• THAT   AND
  • THAT   AND


Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001805 Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA. Full Lenth $362.50
ORF Sequence $245.34


RefSeq Version NM_001805.2, 28872799
Length 1250 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA.
Product CCAAT/enhancer-binding protein epsilon
Comment

Summary: The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq].

RefSeq NP_001796.2
CDS 175..1020
Exon (1)1..684
Exon (2)1..684
Exon (3)685..1201
Translation MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV KPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAV KEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPC SPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM AENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(155)-t, cdbSNP:78537674
complement(390..391)-, cdbSNP:35397008
complement(408)-g, adbSNP:114913626
complement(449)-g, adbSNP:113091402
complement(507..508)-, cdbSNP:34402633
516+c, gdbSNP:2285023
complement(548)-t, cdbSNP:61737804
complement(921)-g, adbSNP:55722931
complement(1035)-g, adbSNP:112420613
complement(1060)-t, cdbSNP:117800045
Gene SymbolCEBPE
Gene SynonymC/EBP-epsilon; CRP1
Chromosome14
Locus Map14q11.2
All Transcripts NM_001805
Title C/EBPepsilon participates in all-trans retinoic acid induction of PI3Kgamma in U937 cells via an intronic matrix attachment region sequence .
Author Cai,R., Cai,X., Chen,B., Xu,W. and Lu,J.
Journal Mol. Biol. Rep. 37 (8), 3795-3800 (2010)
Title Verification of the susceptibility loci on 7p12.2, 10q21.2, and 14q11.2 in precursor B-cell acute lymphoblastic leukemia of childhood .
Author Prasad,R.B., Hosking,F.J., Vijayakrishnan,J., Papaemmanuil,E., Koehler,R., Greaves,M., Sheridan,E., Gast,A., Kinsey,S.E., Lightfoot,T., Roman,E., Taylor,M., Pritchard-Jones,K., Stanulla,M., Schrappe,M., Bartram,C.R., Houlston,R.S., Kumar,R. and Hemminki,K.
Journal Blood 115 (9), 1765-1767 (2010)
Title Loci on 7p12.2, 10q21.2 and 14q11.2 are associated with risk of childhood acute lymphoblastic leukemia .
Author Papaemmanuil,E., Hosking,F.J., Vijayakrishnan,J., Price,A., Olver,B., Sheridan,E., Kinsey,S.E., Lightfoot,T., Roman,E., Irving,J.A., Allan,J.M., Tomlinson,I.P., Taylor,M., Greaves,M. and Houlston,R.S.
Journal Nat. Genet. 41 (9), 1006-1010 (2009)
Title Human C/EBP-epsilon activator and repressor isoforms differentially reprogram myeloid lineage commitment and differentiation .
Author Bedi,R., Du,J., Sharma,A.K., Gomes,I. and Ackerman,S.J.
Journal Blood 113 (2), 317-327 (2009)
Title Inflammatory cytokine production by human neutrophils involves C/EBP transcription factors .
Author Cloutier,A., Guindi,C., Larivee,P., Dubois,C.M., Amrani,A. and McDonald,P.P.
Journal J. Immunol. 182 (1), 563-571 (2009)
Title C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters .
Author Verbeek,W., Gombart,A.F., Chumakov,A.M., Muller,C., Friedman,A.D. and Koeffler,H.P.
Journal Blood 93 (10), 3327-3337 (1999)
Title CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing .
Author Yamanaka,R., Kim,G.D., Radomska,H.S., Lekstrom-Himes,J., Smith,L.T., Antonson,P., Tenen,D.G. and Xanthopoulos,K.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (12), 6462-6467 (1997)
Title Cloning of the novel human myeloid-cell-specific C/EBP-epsilon transcription factor .
Author Chumakov,A.M., Grillier,I., Chumakova,E., Chih,D., Slater,J. and Koeffler,H.P.
Journal Mol. Cell. Biol. 17 (3), 1375-1386 (1997)
Title A novel human CCAAT/enhancer binding protein gene, C/EBPepsilon, is expressed in cells of lymphoid and myeloid lineages and is localized on chromosome 14q11.2 close to the T-cell receptor alpha/delta locus .
Author Antonson,P., Stellan,B., Yamanaka,R. and Xanthopoulos,K.G.
Journal Genomics 35 (1), 30-38 (1996)
Title A family of C/EBP-related proteins capable of forming covalently linked leucine zipper dimers in vitro .
Author Williams,S.C., Cantwell,C.A. and Johnson,P.F.
Journal Genes Dev. 5 (9), 1553-1567 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878