• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001805 Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_001805.3, 356640246
Length 1550 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA.
Product CCAAT/enhancer-binding protein epsilon
Comment

Summary: The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008].

RefSeq NP_001796.2
CDS 521..1366
Misc Feature(1)398..400
Misc Feature(2)1127..1288
Misc Feature(3)1127..1288
Misc Feature(4)1142..1204
Misc Feature(5)1208..1231
Exon (1)1..1030
Gene:CEBPE
Gene Synonym:C/EBP-epsilon; CRP1
Exon (2)1031..1547
Gene:CEBPE
Gene Synonym:C/EBP-epsilon; CRP1
Translation MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV KPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAV KEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPC SPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM AENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(69)-dbSNP:
complement(69)-g, adbSNP:149718019
complement(70)-t, cdbSNP:117280025
complement(90)-g, cdbSNP:2239635
complement(130..139)-, tgcccgaagcdbSNP:200704673
complement(134)-g, adbSNP:111556425
complement(179)-g, adbSNP:12434881
complement(192)-g, adbSNP:116620631
complement(254)-g, adbSNP:139590673
complement(343)-c, adbSNP:150630359
complement(402)-c, adbSNP:181016963
complement(471)-g, cdbSNP:188219814
complement(501)-t, cdbSNP:78537674
complement(554)-g, adbSNP:200723095
complement(555)-t, cdbSNP:201106129
complement(575)-g, cdbSNP:200738630
complement(650)-t, cdbSNP:200138272
complement(658)-g, adbSNP:201515929
complement(697)-g, c, adbSNP:141320203
complement(709)-t, cdbSNP:199734343
complement(723)-t, cdbSNP:201670447
complement(725)-g, adbSNP:146580935
complement(736)-g, adbSNP:200808733
complement(737..738)-, cdbSNP:35397008
complement(742)-g, adbSNP:142854852
complement(743)-t, gdbSNP:148458866
complement(754)-g, adbSNP:114913626
complement(795)-g, adbSNP:113091402
complement(823)-t, cdbSNP:149752323
complement(854..855)-, cdbSNP:34402633
complement(862)-g, cdbSNP:2285023
complement(877)-c, adbSNP:202220573
complement(894)-t, cdbSNP:61737804
complement(930)-t, cdbSNP:140606768
complement(983)-t, gdbSNP:141903485
complement(1042)-dbSNP:
complement(1042)-t, gdbSNP:143427930
complement(1054)-t, gdbSNP:137857228
complement(1106)-t, cdbSNP:147384349
complement(1121)-t, cdbSNP:201257734
complement(1144)-t, cdbSNP:141185489
complement(1232)-t, cdbSNP:201609537
complement(1267)-g, adbSNP:55722931
complement(1314)-t, cdbSNP:199967428
complement(1348)-g, adbSNP:143753215
complement(1362)-t, cdbSNP:149444043
complement(1381)-g, adbSNP:112420613
complement(1406)-t, cdbSNP:117800045
complement(1494)-t, cdbSNP:143030663
Gene SymbolCEBPE
Gene SynonymC/EBP-epsilon; CRP1
Chromosome14
Locus Map14q11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001805 Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA. In-stock $348.00 $299.00 10
Title Genetic polymorphisms in ARID5B, CEBPE, IKZF1 and CDKN2A in relation with risk of acute lymphoblastic leukaemia in adults: a Group for Research on Adult Acute Lymphoblastic Leukaemia (GRAALL) study .
Author Peyrouze,P., Guihard,S., Grardel,N., Berthon,C., Pottier,N., Pigneux,A., Cahn,J.Y., Bene,M.C., Lheritier,V., Delabesse,E., Macintyre,E., Thomas,X., Dombret,H., Ifrah,N. and Cheok,M.
Journal Br. J. Haematol. 159 (5), 599-602 (2012)
Title Double CEBPE-IGH rearrangement due to chromosome duplication and cryptic insertion in an adult with B-cell acute lymphoblastic leukemia .
Author Pierini,V., Nofrini,V., La Starza,R., Barba,G., Vitale,A., Di Raimondo,F., Matteucci,C., Crescenzi,B., Elia,L., Gorello,P., Storlazzi,C.T. and Mecucci,C.
Journal Cancer Genet 204 (10), 563-568 (2011)
Title C/EBPepsilon participates in all-trans retinoic acid induction of PI3Kgamma in U937 cells via an intronic matrix attachment region sequence .
Author Cai,R., Cai,X., Chen,B., Xu,W. and Lu,J.
Journal Mol. Biol. Rep. 37 (8), 3795-3800 (2010)
Title Verification of the susceptibility loci on 7p12.2, 10q21.2, and 14q11.2 in precursor B-cell acute lymphoblastic leukemia of childhood .
Author Prasad,R.B., Hosking,F.J., Vijayakrishnan,J., Papaemmanuil,E., Koehler,R., Greaves,M., Sheridan,E., Gast,A., Kinsey,S.E., Lightfoot,T., Roman,E., Taylor,M., Pritchard-Jones,K., Stanulla,M., Schrappe,M., Bartram,C.R., Houlston,R.S., Kumar,R. and Hemminki,K.
Journal Blood 115 (9), 1765-1767 (2010)
Title Loci on 7p12.2, 10q21.2 and 14q11.2 are associated with risk of childhood acute lymphoblastic leukemia .
Author Papaemmanuil,E., Hosking,F.J., Vijayakrishnan,J., Price,A., Olver,B., Sheridan,E., Kinsey,S.E., Lightfoot,T., Roman,E., Irving,J.A., Allan,J.M., Tomlinson,I.P., Taylor,M., Greaves,M. and Houlston,R.S.
Journal Nat. Genet. 41 (9), 1006-1010 (2009)
Title C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters .
Author Verbeek,W., Gombart,A.F., Chumakov,A.M., Muller,C., Friedman,A.D. and Koeffler,H.P.
Journal Blood 93 (10), 3327-3337 (1999)
Title CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing .
Author Yamanaka,R., Kim,G.D., Radomska,H.S., Lekstrom-Himes,J., Smith,L.T., Antonson,P., Tenen,D.G. and Xanthopoulos,K.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (12), 6462-6467 (1997)
Title Cloning of the novel human myeloid-cell-specific C/EBP-epsilon transcription factor .
Author Chumakov,A.M., Grillier,I., Chumakova,E., Chih,D., Slater,J. and Koeffler,H.P.
Journal Mol. Cell. Biol. 17 (3), 1375-1386 (1997)
Title A novel human CCAAT/enhancer binding protein gene, C/EBPepsilon, is expressed in cells of lymphoid and myeloid lineages and is localized on chromosome 14q11.2 close to the T-cell receptor alpha/delta locus .
Author Antonson,P., Stellan,B., Yamanaka,R. and Xanthopoulos,K.G.
Journal Genomics 35 (1), 30-38 (1996)
Title A family of C/EBP-related proteins capable of forming covalently linked leucine zipper dimers in vitro .
Author Williams,S.C., Cantwell,C.A. and Johnson,P.F.
Journal Genes Dev. 5 (9), 1553-1567 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.