• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001805 Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_001805.3, 356640246
Length 1550 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA.
Product CCAAT/enhancer-binding protein epsilon
Comment

Summary: The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008].

RefSeq NP_001796.2
CDS 521..1366
Misc Feature(1)398..400
Misc Feature(2)1142..1204
Misc Feature(3)1142..1204
Misc Feature(4)1145..1294
Misc Feature(5)order(1151..1153,1160..1165,1172..1177,1184..1186)
Misc Feature(6)1208..1231
Exon (1)1..1030
Gene:CEBPE
Gene Synonym:C/EBP-epsilon; CRP1
Exon (2)1031..1547
Gene:CEBPE
Gene Synonym:C/EBP-epsilon; CRP1
Translation MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV KPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAV KEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPC SPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM AENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(69)-dbSNP:
complement(69)-g, adbSNP:149718019
complement(70)-t, cdbSNP:117280025
90+c, gdbSNP:2239635
complement(130..139)-, tgcccgaagcdbSNP:200704673
complement(134)-g, adbSNP:111556425
complement(179)-g, adbSNP:12434881
complement(192)-g, adbSNP:116620631
complement(254)-g, adbSNP:139590673
complement(343)-c, adbSNP:150630359
complement(402)-c, adbSNP:181016963
complement(412)-t, cdbSNP:370664301
complement(471)-g, cdbSNP:188219814
complement(501)-t, cdbSNP:78537674
complement(505)-t, cdbSNP:370118213
complement(554)-g, adbSNP:200723095
complement(555)-t, cdbSNP:201106129
complement(575)-g, cdbSNP:200738630
complement(620)-t, adbSNP:376629444
complement(650)-t, cdbSNP:200138272
complement(658)-g, adbSNP:201515929
complement(663)-g, adbSNP:369075679
complement(685)-g, adbSNP:374697077
complement(686)-t, cdbSNP:371734898
complement(690)-g, adbSNP:367924607
complement(697)-g, c, adbSNP:141320203
complement(709)-t, cdbSNP:199734343
complement(710)-g, adbSNP:375615547
complement(723)-t, cdbSNP:201670447
complement(725)-g, adbSNP:146580935
complement(736..737)-, cdbSNP:35397008
complement(736)-g, adbSNP:200808733
complement(742)-g, adbSNP:142854852
complement(743)-t, gdbSNP:148458866
complement(754)-g, adbSNP:114913626
complement(765)-g, adbSNP:372292172
complement(795)-g, adbSNP:113091402
complement(799)-g, adbSNP:368706357
complement(823)-t, cdbSNP:149752323
complement(853..854)-, cdbSNP:34402633
862+c, gdbSNP:2285023
complement(871)-g, adbSNP:368474011
complement(877)-c, adbSNP:202220573
complement(894)-t, cdbSNP:61737804
complement(924)-t, cdbSNP:374190826
complement(930)-t, cdbSNP:140606768
complement(983)-t, gdbSNP:141903485
complement(1022)-t, cdbSNP:371549805
complement(1024)-g, adbSNP:371937597
complement(1054)-dbSNP:
complement(1054)-t, gdbSNP:137857228
complement(1078)-t, cdbSNP:372854243
complement(1084)-g, adbSNP:369145261
complement(1085)-g, adbSNP:376534358
complement(1087)-t, cdbSNP:373251741
complement(1106)-t, cdbSNP:147384349
complement(1121)-t, cdbSNP:201257734
complement(1144)-t, cdbSNP:141185489
complement(1159)-g, adbSNP:375672870
complement(1200)-t, cdbSNP:372651475
complement(1231)-t, cdbSNP:367795312
complement(1232)-t, cdbSNP:201609537
complement(1243)-t, cdbSNP:374712257
complement(1267)-g, adbSNP:55722931
complement(1314)-t, cdbSNP:199967428
complement(1348)-g, adbSNP:143753215
complement(1353)-t, cdbSNP:370718175
complement(1362)-t, cdbSNP:149444043
complement(1375)-g, cdbSNP:374665903
complement(1381)-g, adbSNP:112420613
complement(1406)-t, cdbSNP:117800045
complement(1494)-t, cdbSNP:143030663
Gene SymbolCEBPE
Gene SynonymC/EBP-epsilon; CRP1
Chromosome14
Locus Map14q11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001805 Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon (CEBPE), mRNA. In-stock $348.00 $299.00 10
Title miRNA-130a regulates C/EBP-epsilon expression during granulopoiesis .
Author Larsen MT, Hager M, Glenthoj A, Asmar F, Clemmensen SN, Mora-Jensen H, Borregaard N and Cowland JB.
Journal Blood 123 (7), 1079-1089 (2014)
Title Variation at 10p12.2 and 10p14 influences risk of childhood B-cell acute lymphoblastic leukemia and phenotype .
Author Migliorini G, Fiege B, Hosking FJ, Ma Y, Kumar R, Sherborne AL, da Silva Filho MI, Vijayakrishnan J, Koehler R, Thomsen H, Irving JA, Allan JM, Lightfoot T, Roman E, Kinsey SE, Sheridan E, Thompson P, Hoffmann P, Nothen MM, Muhleisen TW, Eisele L, Zimmermann M, Bartram CR, Schrappe M, Greaves M, Stanulla M, Hemminki K and Houlston RS.
Journal Blood 122 (19), 3298-3307 (2013)
Title Identification of functional nucleotide and haplotype variants in the promoter of the CEBPE gene .
Author Ryoo H, Kong M, Kim Y and Lee C.
Journal J. Hum. Genet. 58 (9), 600-603 (2013)
Title Association of three polymorphisms in ARID5B, IKZF1 and CEBPE with the risk of childhood acute lymphoblastic leukemia in a Chinese population .
Author Wang Y, Chen J, Li J, Deng J, Rui Y, Lu Q, Wang M, Tong N, Zhang Z and Fang Y.
Journal Gene 524 (2), 203-207 (2013)
Title Novel susceptibility variants at 10p12.31-12.2 for childhood acute lymphoblastic leukemia in ethnically diverse populations .
Author Xu H, Yang W, Perez-Andreu V, Devidas M, Fan Y, Cheng C, Pei D, Scheet P, Burchard EG, Eng C, Huntsman S, Torgerson DG, Dean M, Winick NJ, Martin PL, Camitta BM, Bowman WP, Willman CL, Carroll WL, Mullighan CG, Bhojwani D, Hunger SP, Pui CH, Evans WE, Relling MV, Loh ML and Yang JJ.
Journal J. Natl. Cancer Inst. 105 (10), 733-742 (2013)
Title C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters .
Author Verbeek W, Gombart AF, Chumakov AM, Muller C, Friedman AD and Koeffler HP.
Journal Blood 93 (10), 3327-3337 (1999)
Title CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing .
Author Yamanaka R, Kim GD, Radomska HS, Lekstrom-Himes J, Smith LT, Antonson P, Tenen DG and Xanthopoulos KG.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (12), 6462-6467 (1997)
Title Cloning of the novel human myeloid-cell-specific C/EBP-epsilon transcription factor .
Author Chumakov AM, Grillier I, Chumakova E, Chih D, Slater J and Koeffler HP.
Journal Mol. Cell. Biol. 17 (3), 1375-1386 (1997)
Title A novel human CCAAT/enhancer binding protein gene, C/EBPepsilon, is expressed in cells of lymphoid and myeloid lineages and is localized on chromosome 14q11.2 close to the T-cell receptor alpha/delta locus .
Author Antonson P, Stellan B, Yamanaka R and Xanthopoulos KG.
Journal Genomics 35 (1), 30-38 (1996)
Title A family of C/EBP-related proteins capable of forming covalently linked leucine zipper dimers in vitro .
Author Williams SC, Cantwell CA and Johnson PF.
Journal Genes Dev. 5 (9), 1553-1567 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.