• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens centromere protein C (CENPC), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu03707 Homo sapiens centromere protein C (CENPC), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu03707C Homo sapiens centromere protein C (CENPC), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001812.2, 68508960
Length 2832 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens centromere protein C (CENPC), mRNA.
Product centromere protein C
Comment

Summary: Centromere protein C 1 is a centromere autoantigen and a component of the inner kinetochore plate. The protein is required for maintaining proper kinetochore size and a timely transition to anaphase. A putative pseudogene exists on chromosome 12. [provided by RefSeq, Jul 2008].

RefSeq NP_001803.2
CDS 184..3015
Misc Feature(1)55..57
Misc Feature(2)202..1059
Misc Feature(3)202..1059
Misc Feature(4)469..471
Misc Feature(5)571..573
Misc Feature(6)619..621
Misc Feature(7)682..684
Misc Feature(8)691..693
Misc Feature(9)712..714
Misc Feature(10)730..732
Misc Feature(11)748..750
Misc Feature(12)856..858
Misc Feature(13)856..858
Misc Feature(14)958..1002
Misc Feature(15)964..966
Misc Feature(16)1069..1839
Misc Feature(17)1129..1131
Misc Feature(18)1129..1131
Misc Feature(19)1180..1182
Misc Feature(20)1498..1500
Misc Feature(21)1633..1680
Misc Feature(22)1741..1743
Misc Feature(23)1753..1755
Misc Feature(24)1783..1785
Misc Feature(25)1795..1797
Misc Feature(26)1795..1797
Misc Feature(27)1855..1905
Misc Feature(28)2308..2310
Misc Feature(29)2311..2313
Misc Feature(30)2344..2346
Misc Feature(31)2383..2385
Misc Feature(32)2392..2460
Misc Feature(33)2419..2421
Misc Feature(34)2470..2472
Misc Feature(35)2500..2502
Misc Feature(36)2521..2577
Misc Feature(37)2749..3003
Misc Feature(38)2851..3012
Exon (1)1..201
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (2)202..248
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (3)249..319
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (4)320..414
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (5)415..514
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (6)515..800
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (7)801..1013
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (8)1014..1627
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (9)1628..1795
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (10)1796..2087
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (11)2088..2234
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (12)2235..2314
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (13)2315..2368
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (14)2369..2473
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (15)2474..2602
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (16)2603..2698
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (17)2699..2853
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (18)2854..2944
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Exon (19)2945..3349
Gene:CENPC
Gene Synonym:CENP-C; CENPC1; hcp-4; MIF2
Translation MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVP NSTRKIKDTCIQSPSKECQKSHPKSVPVSSKKKEASLQFVVEPSEATNRSVQAHEVHQKI LATDVSSKNTPDSKKISSRNINDHHSEADEEFYLSVGSPSVLLDAKTSVSQNVIPSSAQK RETYTFENSVNMLPSSTEVSVKTKKRLNFDDKVMLKKIEIDNKVSDEEDKTSEGQERKPS GSSQNRIRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIVRHAATAPPHSCPPDDTKLIE DEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALLQGRKSREKHHNILPKTLAN DKHSHKPHPVETSQPSDKTVLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQK QRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPP VGSKKSSTRKDKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEESPV YSNSSVRNELPMHHNSSRKSTKKTNQSSKNIRKKTIPLKRQKTATKGNQRVQKFLNAEGS GGIVGHDEISRCSLSEPLESDEADLAKKKNLDCSRSTRSSKNEDNIMTAQNVPLKPQTSG YTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKNDVDDEEVHGSSDDSKQSKVIP KNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISGVLSPDTISSK RKAKENIGKVNKKSNKKRICLDNDERKTNLMVNLGIPLGDPLQPTRVKDPETREIILMDL VRPQDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFYVNFGDLL CTLHETPYILSTGDSFYVPSGNYYNIKNLRNEESVLLFTQIKR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(29)-dbSNP:
complement(29)-t, cdbSNP:35108540
complement(46)-t, cdbSNP:145363683
complement(72)-t, cdbSNP:150026106
complement(134)-g, adbSNP:373778301
complement(253)-dbSNP:
complement(253)-g, adbSNP:369384820
complement(275)-t, cdbSNP:141072717
complement(301)-t, cdbSNP:372910551
complement(308)-t, adbSNP:368845653
complement(322)-dbSNP:
complement(322)-g, cdbSNP:376946836
complement(373)-g, adbSNP:201575627
complement(392)-t, cdbSNP:370084228
complement(394)-t, cdbSNP:375882947
complement(402)-t, gdbSNP:372229056
complement(403)-g, cdbSNP:60820404
complement(413)-t, gdbSNP:376749429
complement(463)-dbSNP:
complement(463)-t, cdbSNP:76729386
complement(524)-dbSNP:
complement(524)-t, cdbSNP:183104004
complement(563)-g, c, adbSNP:372436165
complement(572)-g, cdbSNP:368389423
complement(589)-t, gdbSNP:138967637
complement(612)-g, adbSNP:199649803
complement(648)-g, adbSNP:374387199
complement(698)-t, gdbSNP:370674211
complement(713)-g, cdbSNP:376625931
complement(756)-g, adbSNP:190926374
complement(848)-dbSNP:
complement(848)-t, cdbSNP:370020579
879+a, gdbSNP:355510
complement(950)-t, cdbSNP:201103062
complement(962)-t, cdbSNP:377025154
complement(1010)-t, gdbSNP:374266998
complement(1052)-dbSNP:
complement(1052)-g, adbSNP:369416101
complement(1070)-g, adbSNP:375299160
complement(1172)-c, adbSNP:371671240
complement(1181)-g, adbSNP:200888615
complement(1184)-g, adbSNP:367801598
complement(1193)-t, cdbSNP:200220629
1204+c, tdbSNP:11250
complement(1285)-g, adbSNP:150498437
complement(1321)-t, cdbSNP:368747294
complement(1349)-g, adbSNP:1056787
complement(1432)-t, cdbSNP:142565656
complement(1501)-t, cdbSNP:190294402
complement(1518)-g, adbSNP:367857360
complement(1523)-g, adbSNP:374045875
complement(1533)-g, adbSNP:370280968
complement(1539)-g, adbSNP:377371664
complement(1548)-t, cdbSNP:185918036
complement(1554)-t, adbSNP:201443057
complement(1577)-t, cdbSNP:181597128
complement(1599)-c, adbSNP:377757363
complement(1628)-dbSNP:
complement(1628)-c, adbSNP:141379239
complement(1639)-t, cdbSNP:199691875
complement(1656)-g, adbSNP:372916188
complement(1679)-c, adbSNP:184128058
complement(1680)-g, cdbSNP:369568452
complement(1687)-t, cdbSNP:374698756
complement(1703)-t, adbSNP:371467580
complement(1709)-g, adbSNP:200847573
complement(1731)-g, adbSNP:375452140
complement(1792)-t, cdbSNP:372347198
complement(1797)-dbSNP:
complement(1797)-g, adbSNP:201681976
complement(1837)-t, cdbSNP:371635431
complement(1838)-g, adbSNP:192751329
complement(1847)-t, cdbSNP:374814920
complement(1857)-t, gdbSNP:202179070
complement(1901)-t, cdbSNP:370323217
complement(1975)-t, cdbSNP:377691757
complement(1978)-t, cdbSNP:200110790
complement(1979)-t, cdbSNP:371028405
complement(1993)-t, cdbSNP:114326582
complement(2022..2023)-tt, gcdbSNP:386675510
2022+a, gdbSNP:1056789
complement(2038)-t, cdbSNP:369228189
complement(2081)-t, cdbSNP:200998915
complement(2089)-dbSNP:
complement(2089)-t, adbSNP:369006456
complement(2095)-t, cdbSNP:199972728
complement(2122)-t, cdbSNP:61750808
complement(2152)-g, adbSNP:186769176
complement(2170)-t, adbSNP:375316333
complement(2184)-t, adbSNP:372244871
complement(2197)-t, cdbSNP:183418720
complement(2203)-t, cdbSNP:199856009
complement(2247)-dbSNP:
complement(2247)-g, cdbSNP:189594633
complement(2260)-t, adbSNP:201011714
complement(2349)-dbSNP:
complement(2349)-g, cdbSNP:370777522
complement(2403)-dbSNP:
complement(2403)-g, adbSNP:187437348
complement(2409)-t, cdbSNP:372886452
complement(2414)-t, cdbSNP:369333716
complement(2438)-t, cdbSNP:376096511
complement(2458)-g, cdbSNP:140146155
complement(2460)-t, cdbSNP:17854081
complement(2516)-dbSNP:
complement(2516)-g, adbSNP:267600207
complement(2517)-t, cdbSNP:112599674
complement(2530)-t, cdbSNP:369662983
complement(2566)-t, cdbSNP:201718172
complement(2572)-t, cdbSNP:372008911
complement(2590)-t, cdbSNP:368088165
complement(2592)-g, adbSNP:374931553
complement(2656)-dbSNP:
complement(2656)-t, cdbSNP:371916667
complement(2658)-t, cdbSNP:368539460
complement(2665)-t, cdbSNP:199998234
complement(2766)-dbSNP:
complement(2766)-t, cdbSNP:112493476
complement(2796..2797)-, tdbSNP:35453375
complement(2817)-t, gdbSNP:370440331
complement(2877)-dbSNP:
complement(2877)-g, adbSNP:372473401
complement(2902)-g, adbSNP:370870458
complement(2922)-g, cdbSNP:376426502
complement(2927)-g, adbSNP:200509560
complement(2928)-t, cdbSNP:201433526
complement(2933)-t, cdbSNP:376889812
complement(2984)-dbSNP:
complement(2984)-t, cdbSNP:374282973
complement(3028)-t, gdbSNP:11544339
complement(3040)-t, cdbSNP:144515314
complement(3054)-t, cdbSNP:149259908
complement(3057)-t, adbSNP:371260217
complement(3091)-t, gdbSNP:116290223
complement(3136)-g, adbSNP:186886346
complement(3139)-g, cdbSNP:7662513
complement(3139)-g, cdbSNP:111185783
complement(3171)-t, adbSNP:201579401
complement(3173)-t, adbSNP:200336031
complement(3174..3175)-, tgdbSNP:55872090
complement(3175..3176)-, atdbSNP:199926074
complement(3175)-t, cdbSNP:201227524
complement(3177)-c, adbSNP:374395451
complement(3259..3260)-, cdbSNP:35085170
complement(3298)-t, cdbSNP:370309544
complement(3302)-g, adbSNP:200306120
complement(3314)-g, cdbSNP:138272228
complement(3329)-t, gdbSNP:7692496
Gene SymbolCENPC
Gene SynonymCENP-C; CENPC1; hcp-4; MIF2
Chromosome4
Locus Map4q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001812 Homo sapiens centromere protein C (CENPC), mRNA. On-demand $279.00 12-14
NM_001812 Homo sapiens centromere protein C (CENPC), mRNA. On-demand $279.00 12-14
NM_001812 Homo sapiens centromere protein C (CENPC), mRNA. On-demand $279.00 12-14
Title CENP-C facilitates the recruitment of M18BP1 to centromeric chromatin .
Author Dambacher S, Deng W, Hahn M, Sadic D, Frohlich J, Nuber A, Hoischen C, Diekmann S, Leonhardt H and Schotta G.
Journal Nucleus 3 (1), 101-110 (2012)
Title Direct binding of Cenp-C to the Mis12 complex joins the inner and outer kinetochore .
Author Screpanti E, De Antoni A, Alushin GM, Petrovic A, Melis T, Nogales
Journal Curr. Biol. 21 (5), 391-398 (2011)
Title DNMT3B interacts with constitutive centromere protein CENP-C to modulate DNA methylation and the histone code at centromeric regions .
Author Gopalakrishnan S, Sullivan BA, Trazzi S, Della Valle G and Robertson KD.
Journal Hum. Mol. Genet. 18 (17), 3178-3193 (2009)
Title Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population .
Author Yosifova A, Mushiroda T, Stoianov D, Vazharova R, Dimova I, Karachanak S, Zaharieva I, Milanova V, Madjirova N, Gerdjikov I, Tolev T, Velkova S, Kirov G, Owen MJ, O'Donovan MC, Toncheva D and Nakamura Y.
Journal J Affect Disord 117 (1-2), 87-97 (2009)
Title The C-terminal domain of CENP-C displays multiple and critical functions for mammalian centromere formation .
Author Trazzi S, Perini G, Bernardoni R, Zoli M, Reese JC, Musacchio A and Della Valle G.
Journal PLoS ONE 4 (6), E5832 (2009)
Title Human chromosome pellicle antibody recognizing centromere protein-C (CENP-C), the main component of the kinetochore .
Author Xie Y, Ni ZM, Gu JR, Wong P, Wu WQ and Xu GW.
Journal Cell Res. 7 (1), 13-19 (1997)
Title Specific interaction between human kinetochore protein CENP-C and a nucleolar transcriptional regulator .
Author Pluta AF and Earnshaw WC.
Journal J. Biol. Chem. 271 (31), 18767-18774 (1996)
Title FISH mapping of centromere protein C (CENPC) on human chromosome 4q31-->q21 .
Author Xie Y and Heng HH.
Journal Cytogenet. Cell Genet. 74 (3), 192-193 (1996)
Title Sequence homologies and linkage group conservation of the human and mouse Cenpc genes .
Author McKay S, Thomson E and Cooke H.
Journal Genomics 22 (1), 36-40 (1994)
Title CENP-C, an autoantigen in scleroderma, is a component of the human inner kinetochore plate .
Author Saitoh H, Tomkiel J, Cooke CA, Ratrie H 3rd, Maurer M, Rothfield NF and Earnshaw WC.
Journal Cell 70 (1), 115-125 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.