• THAT   AND
  • THAT   AND


Homo sapiens creatine kinase, muscle (CKM), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001824 Homo sapiens creatine kinase, muscle (CKM), mRNA. Full Lenth $498.51
ORF Sequence $332.34


RefSeq Version NM_001824.3, 299473751
Length 1719 bp
Structure linear
Update Date 10-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens creatine kinase, muscle (CKM), mRNA.
Product creatine kinase M-type
Comment

Summary: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq].

RefSeq NP_001815.2
CDS 174..1319
Exon (1)1..155
Exon (2)1..155
Exon (3)156..366
Exon (4)367..521
Exon (5)522..654
Exon (6)655..826
Exon (7)827..950
Exon (8)951..1140
Exon (9)1141..1656
Translation MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTG VDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT EKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM VEMEKKLEKGQSIDDMIPAQK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(34)-t, gdbSNP:76120412
complement(99)-t, adbSNP:111770860
complement(100)-t, adbSNP:111323781
complement(119)-c, adbSNP:12974541
387+a, gdbSNP:1803285
389+g, tdbSNP:11559023
421+a, gdbSNP:11559024
509+c, tdbSNP:17875604
542+c, tdbSNP:1133190
552+c, gdbSNP:17875653
complement(670)-g, adbSNP:17357122
800+a, cdbSNP:17875616
complement(846)-g, adbSNP:17850202
901+c, gdbSNP:17875625
complement(905)-g, cdbSNP:60621776
complement(906)-t, gdbSNP:56905146
complement(1252)-c, adbSNP:76072092
1292+c, tdbSNP:4884
complement(1387)-t, cdbSNP:117172220
1415+g, tdbSNP:8188
1441+c, tdbSNP:17875628
1527+a, gdbSNP:9976
1577+c, tdbSNP:17875629
complement(1642)-t, cdbSNP:75379365
complement(1655)-t, adbSNP:111843749
Gene SymbolCKM
Gene SynonymCKMM; M-CK
Chromosome19
Locus Map19q13.2-q13.3
All Transcripts NM_001824
Title Diagnosis of ischemic heart disease using CK-MB, troponin-I and ischemia modified albumin .
Author Dawie,J., Chawla,R., Worku,Y. and Azazh,A.
Journal Ethiop. Med. J. 49 (1), 25-33 (2011)
Title Association of single-nucleotide polymorphisms from 17 candidate genes with baseline symptom-limited exercise test duration and decrease in duration over 20 years: the Coronary Artery Risk Development in Young Adults (CARDIA) fitness study .
Author Sarzynski,M.A., Rankinen,T., Sternfeld,B., Grove,M.L., Fornage,M., Jacobs,D.R. Jr., Sidney,S. and Bouchard,C.
Journal Circ Cardiovasc Genet 3 (6), 531-538 (2010)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Temporal changes in circulating P-selectin, plasminogen activator inhibitor-1, magnesium, and creatine kinase after percutaneous coronary intervention .
Author Ying,S.Q., Xiang,M.X., Fang,L. and Wang,J.A.
Journal J Zhejiang Univ Sci B 11 (8), 575-582 (2010)
Title Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia .
Author Jugessur,A., Shi,M., Gjessing,H.K., Lie,R.T., Wilcox,A.J., Weinberg,C.R., Christensen,K., Boyles,A.L., Daack-Hirsch,S., Nguyen,T.T., Christiansen,L., Lidral,A.C. and Murray,J.C.
Journal PLoS ONE 5 (7), E11493 (2010)
Title Muscle creatine kinase isoenzyme expression in adult human brain .
Author Hamburg,R.J., Friedman,D.L., Olson,E.N., Ma,T.S., Cortez,M.D., Goodman,C., Puleo,P.R. and Perryman,M.B.
Journal J. Biol. Chem. 265 (11), 6403-6409 (1990)
Title Spermatogenesis-related change in the synthesis of the creatine kinase B-type and M-type isoforms in human spermatozoa .
Author Huszar,G. and Vigue,L.
Journal Mol. Reprod. Dev. 25 (3), 258-262 (1990)
Title A long-range restriction map of the human chromosome 19q13 region: close physical linkage between CKMM and the ERCC1 and ERCC2 genes .
Author Smeets,H., Bachinski,L., Coerwinkel,M., Schepens,J., Hoeijmakers,J., van Duin,M., Grzeschik,K.H., Weber,C.A., de Jong,P., Siciliano,M.J. et al.
Journal Am. J. Hum. Genet. 46 (3), 492-501 (1990)
Title Developmental regulation and tissue-specific expression of the human muscle creatine kinase gene .
Author Trask,R.V., Strauss,A.W. and Billadello,J.J.
Journal J. Biol. Chem. 263 (32), 17142-17149 (1988)
Title cDNA cloning and mapping of the human creatine kinase M gene to 19q13 .
Author Nigro,J.M., Schweinfest,C.W., Rajkovic,A., Pavlovic,J., Jamal,S., Dottin,R.P., Hart,J.T., Kamarck,M.E., Rae,P.M., Carty,M.D. et al.
Journal Am. J. Hum. Genet. 40 (2), 115-125 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878