• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens creatine kinase, muscle (CKM), mRNA.


RefSeq Accession Definition Services Price Order
NM_001824 Homo sapiens creatine kinase, muscle (CKM), mRNA. ORF Sequence $332.34
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001824.4, 388490199
Length 1666 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens creatine kinase, muscle (CKM), mRNA.
Product creatine kinase M-type
Comment

Summary: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008].

RefSeq NP_001815.2
CDS 176..1321
Misc Feature(1)221..1294
Misc Feature(2)221..1294
Misc Feature(3)order(389..391,776..778,869..871,1022..1024,1028..1030)
Misc Feature(4)order(557..559,563..565,569..571,746..748,857..859,
Misc Feature(5)order(1124..1153,1160..1189)
Exon (1)1..157
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (2)158..368
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (3)369..523
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (4)524..656
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (5)657..828
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (6)829..952
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (7)953..1142
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (8)1143..1658
Gene:CKM
Gene Synonym:CKMM; M-CK
Translation MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTG VDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT EKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM VEMEKKLEKGQSIDDMIPAQK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(101)-dbSNP:
complement(101)-t, c, adbSNP:111770860
complement(102)-t, c, adbSNP:111323781
complement(121)-c, adbSNP:12974541
complement(238)-g, adbSNP:138224618
complement(265)-c, adbSNP:145633772
complement(302)-g, c, adbSNP:140651487
complement(336)-t, cdbSNP:201470105
complement(338)-t, cdbSNP:201048164
complement(389)-dbSNP:
complement(389)-g, adbSNP:1803285
complement(391)-t, g, adbSNP:11559023
complement(422)-t, cdbSNP:200170574
complement(423)-g, adbSNP:11559024
complement(429)-c, adbSNP:149197296
complement(511)-t, cdbSNP:17875604
complement(544)-dbSNP:
complement(544)-t, cdbSNP:1133190
complement(554)-g, cdbSNP:17875653
complement(566)-t, cdbSNP:200253404
complement(570)-t, cdbSNP:147574145
complement(617)-g, adbSNP:201797734
complement(629)-g, adbSNP:149872015
complement(630)-t, cdbSNP:146705516
complement(633)-g, adbSNP:190519310
complement(672)-dbSNP:
complement(672)-g, adbSNP:17357122
complement(676)-g, c, adbSNP:150802782
complement(690)-t, gdbSNP:141322657
complement(702)-g, adbSNP:139922517
complement(714)-g, adbSNP:145987658
complement(715)-g, cdbSNP:201284328
complement(743)-g, cdbSNP:201705552
complement(766)-g, adbSNP:142896147
complement(767)-t, cdbSNP:138317169
complement(802)-c, adbSNP:17875616
complement(848)-dbSNP:
complement(848)-g, adbSNP:17850202
complement(903)-g, cdbSNP:17875625
complement(907)-g, cdbSNP:60621776
complement(908)-t, gdbSNP:56905146
complement(927)-g, cdbSNP:149354459
complement(975)-dbSNP:
complement(975)-t, gdbSNP:138693691
complement(999)-t, cdbSNP:200633759
complement(1011)-t, cdbSNP:201697202
complement(1070)-g, cdbSNP:150271912
complement(1088)-g, adbSNP:185267891
complement(1156)-dbSNP:
complement(1156)-t, cdbSNP:141074527
complement(1180)-g, adbSNP:201733122
complement(1192)-g, adbSNP:146587949
complement(1221)-t, cdbSNP:199913939
complement(1254)-c, adbSNP:76072092
complement(1285)-g, cdbSNP:147729252
complement(1294)-t, cdbSNP:4884
complement(1319)-g, adbSNP:142092440
complement(1341)-g, adbSNP:202146659
complement(1389)-t, cdbSNP:117172220
complement(1417)-t, gdbSNP:8188
complement(1443)-t, cdbSNP:17875628
complement(1529)-g, adbSNP:9976
complement(1579)-t, cdbSNP:17875629
complement(1632)-g, adbSNP:186189112
complement(1644)-t, cdbSNP:75379365
complement(1657)-t, adbSNP:111843749
Gene SymbolCKM
Gene SynonymCKMM; M-CK
Chromosome19
Locus Map19q13.32
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001824 Homo sapiens creatine kinase, muscle (CKM), mRNA. Full Length $483.14
ORF Sequence $332.34
Title Comparison of the prognosis of spontaneous and percutaneous coronary intervention-related myocardial infarction .
Author Leonardi,S., Thomas,L., Neely,M.L., Tricoci,P., Lopes,R.D., White,H.D., Armstrong,P.W., Giugliano,R.P., Antman,E.M., Califf,R.M., Newby,L.K. and Mahaffey,K.W.
Journal J. Am. Coll. Cardiol. 60 (22), 2296-2304 (2012)
Title Creatine kinase MM TaqI and methylenetetrahydrofolate reductase C677T and A1298C gene polymorphisms influence exercise-induced C-reactive protein levels .
Author Miranda-Vilela,A.L., Akimoto,A.K., Lordelo,G.S., Pereira,L.C., Grisolia,C.K. and Klautau-Guimaraes Mde,N.
Journal Eur. J. Appl. Physiol. 112 (3), 941-950 (2012)
Title Creatine kinase MM TaqI and methylenetetrahydrofolate reductase C677T and A1298C gene polymorphisms influence exercise-induced C-reactive protein levels .
Author Miranda-Vilela,A.L., Akimoto,A.K., Lordelo,G.S., Pereira,L.C., Grisolia,C.K. and Klautau-Guimaraes Mde,N.
Journal Eur. J. Appl. Physiol. 112 (1), 183-192 (2012)
Title Muscle creatine kinase deficiency triggers both actin depolymerization and desmin disorganization by advanced glycation end products in dilated cardiomyopathy .
Author Diguet,N., Mallat,Y., Ladouce,R., Clodic,G., Prola,A., Tritsch,E., Blanc,J., Larcher,J.C., Delcayre,C., Samuel,J.L., Friguet,B., Bolbach,G., Li,Z. and Mericskay,M.
Journal J. Biol. Chem. 286 (40), 35007-35019 (2011)
Title Dissimilarity in the folding of human cytosolic creatine kinase isoenzymes .
Author Wang,Y., Wang,S., Gao,Y.S., Chen,Z., Zhou,H.M. and Yan,Y.B.
Journal PLoS ONE 6 (9), E24681 (2011)
Title Muscle creatine kinase isoenzyme expression in adult human brain .
Author Hamburg,R.J., Friedman,D.L., Olson,E.N., Ma,T.S., Cortez,M.D., Goodman,C., Puleo,P.R. and Perryman,M.B.
Journal J. Biol. Chem. 265 (11), 6403-6409 (1990)
Title Spermatogenesis-related change in the synthesis of the creatine kinase B-type and M-type isoforms in human spermatozoa .
Author Huszar,G. and Vigue,L.
Journal Mol. Reprod. Dev. 25 (3), 258-262 (1990)
Title A long-range restriction map of the human chromosome 19q13 region: close physical linkage between CKMM and the ERCC1 and ERCC2 genes .
Author Smeets,H., Bachinski,L., Coerwinkel,M., Schepens,J., Hoeijmakers,J., van Duin,M., Grzeschik,K.H., Weber,C.A., de Jong,P., Siciliano,M.J. et al.
Journal Am. J. Hum. Genet. 46 (3), 492-501 (1990)
Title Developmental regulation and tissue-specific expression of the human muscle creatine kinase gene .
Author Trask,R.V., Strauss,A.W. and Billadello,J.J.
Journal J. Biol. Chem. 263 (32), 17142-17149 (1988)
Title cDNA cloning and mapping of the human creatine kinase M gene to 19q13 .
Author Nigro,J.M., Schweinfest,C.W., Rajkovic,A., Pavlovic,J., Jamal,S., Dottin,R.P., Hart,J.T., Kamarck,M.E., Rae,P.M., Carty,M.D. et al.
Journal Am. J. Hum. Genet. 40 (2), 115-125 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878