• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens creatine kinase, muscle (CKM), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001824 Homo sapiens creatine kinase, muscle (CKM), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_001824.4, 388490199
Length 1666 bp
Structure linear
Update Date 30-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens creatine kinase, muscle (CKM), mRNA.
Product creatine kinase M-type
Comment

Summary: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008].

RefSeq NP_001815.2
CDS 176..1321
Misc Feature(1)221..1294
Misc Feature(2)221..1294
Misc Feature(3)order(389..391,776..778,869..871,1022..1024,1028..1030)
Misc Feature(4)order(557..559,563..565,569..571,746..748,857..859,
Misc Feature(5)order(1124..1153,1160..1189)
Exon (1)1..157
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (2)158..368
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (3)369..523
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (4)524..656
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (5)657..828
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (6)829..952
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (7)953..1142
Gene:CKM
Gene Synonym:CKMM; M-CK
Exon (8)1143..1658
Gene:CKM
Gene Synonym:CKMM; M-CK
Translation MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTG VDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT EKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM VEMEKKLEKGQSIDDMIPAQK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(37)-dbSNP:
complement(37)-g, adbSNP:371601035
complement(101)-t, c, adbSNP:111770860
complement(102)-t, c, adbSNP:111323781
complement(121)-c, adbSNP:12974541
complement(170)-dbSNP:
complement(170)-g, cdbSNP:371907095
complement(184)-g, adbSNP:368649875
complement(209)-t, gdbSNP:373928921
complement(238)-g, adbSNP:138224618
complement(246)-t, cdbSNP:377118696
complement(265)-c, adbSNP:145633772
complement(302)-t, g, c, adbSNP:140651487
complement(303)-t, cdbSNP:372629132
complement(321)-t, gdbSNP:371827047
complement(336)-t, cdbSNP:201470105
complement(338)-t, cdbSNP:201048164
complement(388)-dbSNP:
complement(388)-g, adbSNP:377725988
389+a, gdbSNP:1803285
391+a, g, tdbSNP:11559023
complement(406)-g, adbSNP:374628279
complement(409)-g, adbSNP:370934579
complement(422)-t, cdbSNP:200170574
complement(423)-t, cdbSNP:386519309
complement(423)-g, adbSNP:11559024
complement(429)-c, adbSNP:149197296
complement(447)-g, cdbSNP:369274678
complement(487)-g, cdbSNP:377387152
complement(505)-g, cdbSNP:373212762
complement(511)-t, cdbSNP:386544917
511+c, tdbSNP:17875604
544+dbSNP:
544+c, tdbSNP:1133190
complement(554)-g, cdbSNP:17875653
complement(566)-t, cdbSNP:200253404
complement(570)-t, cdbSNP:147574145
complement(579)-t, cdbSNP:370269966
complement(590)-t, cdbSNP:367804619
complement(598)-t, cdbSNP:376033705
complement(617)-g, adbSNP:201797734
complement(626)-g, adbSNP:371426787
complement(627)-t, cdbSNP:377002933
complement(629)-g, adbSNP:149872015
complement(630)-t, cdbSNP:146705516
complement(633)-g, adbSNP:190519310
complement(634)-c, adbSNP:370802777
complement(672)-dbSNP:
complement(672)-g, adbSNP:17357122
complement(676)-g, c, adbSNP:150802782
complement(682)-g, cdbSNP:372948338
complement(690)-t, gdbSNP:141322657
complement(702)-g, adbSNP:139922517
complement(714)-g, adbSNP:145987658
complement(715)-g, cdbSNP:201284328
complement(743)-g, cdbSNP:201705552
complement(757)-g, adbSNP:373944704
complement(766)-g, adbSNP:142896147
complement(767)-t, cdbSNP:138317169
complement(802)-c, adbSNP:17875616
complement(802)-c, adbSNP:386544918
complement(825)-t, adbSNP:373872310
complement(848)-dbSNP:
complement(848)-g, adbSNP:17850202
complement(881)-t, gdbSNP:370365708
complement(882)-t, cdbSNP:367853842
complement(901)-t, cdbSNP:371276267
complement(903)-g, cdbSNP:17875625
complement(907)-g, cdbSNP:60621776
complement(908)-t, gdbSNP:56905146
complement(927)-g, cdbSNP:149354459
complement(938)-g, cdbSNP:372379123
complement(975)-dbSNP:
complement(975)-t, gdbSNP:138693691
complement(999)-t, cdbSNP:200633759
complement(1003)-g, adbSNP:374180272
complement(1011)-t, cdbSNP:201697202
complement(1045)-c, adbSNP:370775757
complement(1070)-g, cdbSNP:150271912
complement(1081)-t, cdbSNP:375831711
complement(1088)-g, adbSNP:185267891
complement(1100)-g, cdbSNP:374105815
complement(1180)-dbSNP:
complement(1180)-g, adbSNP:201733122
complement(1192)-g, adbSNP:146587949
complement(1198)-t, cdbSNP:373133726
complement(1221)-t, cdbSNP:199913939
complement(1254)-g, c, adbSNP:76072092
complement(1265)-g, cdbSNP:377736202
complement(1274)-g, adbSNP:373999453
complement(1285)-g, cdbSNP:147729252
complement(1294)-t, cdbSNP:386596147
1294+c, tdbSNP:4884
complement(1303)-g, cdbSNP:376809982
complement(1319)-g, adbSNP:142092440
complement(1324)-t, cdbSNP:368059895
complement(1341)-g, adbSNP:202146659
complement(1342)-t, cdbSNP:373583683
complement(1367)-t, cdbSNP:370315406
complement(1368)-t, cdbSNP:371920217
complement(1389)-t, cdbSNP:117172220
complement(1405)-t, gdbSNP:370579433
1417+g, tdbSNP:8188
complement(1443)-t, cdbSNP:17875628
1529+a, gdbSNP:9976
complement(1579)-t, cdbSNP:17875629
complement(1632)-g, adbSNP:186189112
complement(1644)-t, cdbSNP:75379365
complement(1657)-t, adbSNP:111843749
Gene SymbolCKM
Gene SynonymCKMM; M-CK
Chromosome19
Locus Map19q13.32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001824 Homo sapiens creatine kinase, muscle (CKM), mRNA. On-demand $549.00 14
XM_005258497 PREDICTED: Homo sapiens creatine kinase, muscle (CKM), transcript variant X1, mRNA. On-demand $699.00 18
Title Three-dimensional mapping of the creatine kinase enzyme reaction rate in muscles of the lower leg .
Author Parasoglou P, Xia D, Chang G, Convit A and Regatte RR.
Journal NMR Biomed 26 (9), 1142-1151 (2013)
Title Disrupting of E79 and K138 interaction is responsible for human muscle creatine kinase deficiency diseases .
Author Wu QY, Li F, Guo HY, Cao J, Chen C, Chen W, Zeng LY, Li ZY, Wang XY and Xu KL.
Journal Int. J. Biol. Macromol. 54, 216-224 (2013)
Title Comparison of the prognosis of spontaneous and percutaneous coronary intervention-related myocardial infarction .
Author Leonardi S, Thomas L, Neely ML, Tricoci P, Lopes RD, White HD, Armstrong PW, Giugliano RP, Antman EM, Califf RM, Newby LK and Mahaffey KW.
Journal J. Am. Coll. Cardiol. 60 (22), 2296-2304 (2012)
Title Biomarker level improves the diagnosis of embolic source in ischemic stroke of unknown origin .
Author Santamarina E, Penalba A, Garcia-Berrocoso T, Delgado P, Quintana M, Gonzalez-Alujas T, Ribo M, Maisterra O, Molina CA, Evangelista A, Alvarez-Sabin J and Montaner J.
Journal J. Neurol. 259 (12), 2538-2545 (2012)
Title Dissimilarity in the folding of human cytosolic creatine kinase isoenzymes .
Author Wang Y, Wang S, Gao YS, Chen Z, Zhou HM and Yan YB.
Journal PLoS ONE 6 (9), E24681 (2011)
Title Muscle creatine kinase isoenzyme expression in adult human brain .
Author Hamburg RJ, Friedman DL, Olson EN, Ma TS, Cortez MD, Goodman C, Puleo PR and Perryman MB.
Journal J. Biol. Chem. 265 (11), 6403-6409 (1990)
Title Spermatogenesis-related change in the synthesis of the creatine kinase B-type and M-type isoforms in human spermatozoa .
Author Huszar G and Vigue L.
Journal Mol. Reprod. Dev. 25 (3), 258-262 (1990)
Title A long-range restriction map of the human chromosome 19q13 region: close physical linkage between CKMM and the ERCC1 and ERCC2 genes .
Author Smeets H, Bachinski L, Coerwinkel M, Schepens J, Hoeijmakers J, van Duin M, Grzeschik KH, Weber CA, de Jong P and Siciliano MJ.
Journal Am. J. Hum. Genet. 46 (3), 492-501 (1990)
Title Developmental regulation and tissue-specific expression of the human muscle creatine kinase gene .
Author Trask RV, Strauss AW and Billadello JJ.
Journal J. Biol. Chem. 263 (32), 17142-17149 (1988)
Title cDNA cloning and mapping of the human creatine kinase M gene to 19q13 .
Author Nigro,J.M., Schweinfest,C.W., Rajkovic,A., Pavlovic,J., Jamal,S., Dottin,R.P., Hart,J.T., Kamarck,M.E., Rae,P.M., Carty,M.D. et al.
Journal Am. J. Hum. Genet. 40 (2), 115-125 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.