• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens crystallin, alpha B (CRYAB), mRNA.


RefSeq Accession Definition Services Price Order
NM_001885 Homo sapiens crystallin, alpha B (CRYAB), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_001885.1, 4503056
Length 691 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens crystallin, alpha B (CRYAB), mRNA.
Product alpha-crystallin B chain
Comment

Summary: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (sHSP also known as the HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy. [provided by RefSeq, Jul 2008].

RefSeq NP_001876.1
CDS 26..553
Misc Feature(1)26..202
Misc Feature(2)26..202
Misc Feature(3)80..82
Misc Feature(4)80..82
Misc Feature(5)86..88
Misc Feature(6)89..91
Misc Feature(7)143..508
Misc Feature(8)152..154
Misc Feature(9)158..160
Misc Feature(10)158..160
Misc Feature(11)167..169
Misc Feature(12)173..175
Misc Feature(13)182..184
Misc Feature(14)200..202
Misc Feature(15)200..202
Misc Feature(16)203..205
Misc Feature(17)224..475
Misc Feature(18)order(227..241,257..259,263..265,269..274,383..385,
Misc Feature(19)227..229
Misc Feature(20)251..253
Misc Feature(21)269..271
Misc Feature(22)299..301
Misc Feature(23)299..301
Misc Feature(24)521..523
Misc Feature(25)521..523
Misc Feature(26)533..535
Misc Feature(27)545..547
Misc Feature(28)548..550
Exon (1)1..226
Gene:CRYAB
Gene Synonym:CRYA2; CTPP2; HSPB5
Exon (2)227..349
Gene:CRYAB
Gene Synonym:CRYA2; CTPP2; HSPB5
Exon (3)350..691
Gene:CRYAB
Gene Synonym:CRYA2; CTPP2; HSPB5
Translation MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(52)-t, cdbSNP:142776559
complement(82)-c, adbSNP:11549439
complement(85)-g, adbSNP:4252582
complement(85)-, cdbSNP:281865141
complement(100)-g, cdbSNP:199510583
complement(110)-g, cdbSNP:148500053
complement(113)-t, gdbSNP:11549440
complement(140)-g, cdbSNP:145768025
complement(141)-g, adbSNP:149787233
complement(147)-c, adbSNP:2234703
complement(177)-t, cdbSNP:2234704
complement(190)-g, c, adbSNP:2228387
complement(223)-t, cdbSNP:143101974
complement(230)-dbSNP:
complement(230)-g, adbSNP:139750142
complement(238)-t, cdbSNP:17850134
complement(294)-t, gdbSNP:201474470
complement(295..296)-, tdbSNP:34725211
complement(345)-t, cdbSNP:144451841
complement(368)-dbSNP:
complement(368)-, tdbSNP:281865142
complement(383)-g, adbSNP:104894201
complement(476)-t, cdbSNP:104894202
complement(485)-t, cdbSNP:150516929
complement(495)-t, cdbSNP:141638421
complement(510)-g, adbSNP:199861008
complement(512)-g, adbSNP:186242388
complement(535)-g, adbSNP:147970333
complement(539)-g, cdbSNP:11549441
complement(541)-t, gdbSNP:143500486
complement(551)-t, adbSNP:1801966
complement(585..587)-, cttdbSNP:71803586
complement(689)-t, c, adbSNP:112204677
Gene SymbolCRYAB
Gene SynonymCRYA2; CTPP2; HSPB5
Chromosome11
Locus Map11q22.3-q23.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001885 Homo sapiens crystallin, alpha B (CRYAB), mRNA. Full Length $200.39
ORF Sequence $159.00
Title The small heat-shock protein alphaB-crystallin uses different mechanisms of chaperone action to prevent the amorphous versus fibrillar aggregation of alpha-lactalbumin .
Author Kulig,M. and Ecroyd,H.
Journal Biochem. J. 448 (3), 343-352 (2012)
Title Binding determinants of the small heat shock protein, alphaB-crystallin: recognition of the 'IxI' motif .
Author Delbecq,S.P., Jehle,S. and Klevit,R.
Journal EMBO J. 31 (24), 4587-4594 (2012)
Title Expression of alphaB-crystallin overrides the anti-apoptotic activity of XIAP .
Author Lee,J.S., Kim,H.Y., Jeong,N.Y., Lee,S.Y., Yoon,Y.G., Choi,Y.H., Yan,C., Chu,I.S., Koh,H., Park,H.T. and Yoo,Y.H.
Journal Neuro-oncology 14 (11), 1332-1345 (2012)
Title Beneficial effects of alphaB-crystallin in spinal cord contusion injury .
Author Klopstein,A., Santos-Nogueira,E., Francos-Quijorna,I., Redensek,A., David,S., Navarro,X. and Lopez-Vales,R.
Journal J. Neurosci. 32 (42), 14478-14488 (2012)
Title The role of small heat-shock protein alphaB-crystalline (HspB5) in .
Author Cherneva,R.V., Georgiev,O.B., Petrova,D.S., Trifonova,N.L., Stamenova,M., Ivanova,V. and Vlasov,V.I.
Journal Int J Chron Obstruct Pulmon Dis 7, 633-640 (2012)
Title Site-specific glycation of lens crystallins by ascorbic acid .
Author Ortwerth,B.J., Slight,S.H., Prabhakaram,M., Sun,Y. and Smith,J.B.
Journal Biochim. Biophys. Acta 1117 (2), 207-215 (1992)
Title Accumulation of alpha B-crystallin in brains of patients with Alexander's disease is not due to an abnormality of the 5'-flanking and coding sequence of the genomic DNA .
Author Iwaki,A., Iwaki,T., Goldman,J.E., Ogomori,K., Tateishi,J. and Sakaki,Y.
Journal Neurosci. Lett. 140 (1), 89-92 (1992)
Title Copurification of small heat shock protein with alpha B crystallin from human skeletal muscle .
Author Kato,K., Shinohara,H., Goto,S., Inaguma,Y., Morishita,R. and Asano,T.
Journal J. Biol. Chem. 267 (11), 7718-7725 (1992)
Title Cellular distribution of alpha B-crystallin in non-lenticular tissues .
Author Iwaki,T., Kume-Iwaki,A. and Goldman,J.E.
Journal J. Histochem. Cytochem. 38 (1), 31-39 (1990)
Title The primary structure of the B2 chain of human alpha-crystallin .
Author Kramps,J.A., de Man,B.M. and de Jong,W.W.
Journal FEBS Lett. 74 (1), 82-84 (1977)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878