• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens crystallin, alpha B (CRYAB), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu16676 Homo sapiens crystallin, alpha B (CRYAB), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu16676C Homo sapiens crystallin, alpha B (CRYAB), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001885.2, 577019569
Length 528 bp
Structure linear
Update Date 20-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens crystallin, alpha B (CRYAB), transcript variant 1, mRNA.
Product alpha-crystallin B chain
Comment

Summary: Mammalian lens crystallins are divided into alpha, beta, and gamma families. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014].


Transcript Variant: This variant (1) represents the longest transcript. Variants 1-3 encode the same protein.

RefSeq NP_001876.1
CDS 308..835
Misc Feature(1)251..253
Misc Feature(2)308..484
Misc Feature(3)308..484
Misc Feature(4)338..790
Misc Feature(5)362..364
Misc Feature(6)362..364
Misc Feature(7)368..370
Misc Feature(8)371..373
Misc Feature(9)434..436
Misc Feature(10)440..442
Misc Feature(11)440..442
Misc Feature(12)449..451
Misc Feature(13)455..457
Misc Feature(14)464..466
Misc Feature(15)482..484
Misc Feature(16)482..484
Misc Feature(17)485..487
Misc Feature(18)506..757
Misc Feature(19)order(509..523,539..541,545..547,551..556,665..667,
Misc Feature(20)509..511
Misc Feature(21)533..535
Misc Feature(22)551..553
Misc Feature(23)581..583
Misc Feature(24)581..583
Misc Feature(25)803..805
Misc Feature(26)803..805
Misc Feature(27)815..817
Misc Feature(28)827..829
Misc Feature(29)830..832
Exon (1)1..109
Gene:CRYAB
Gene Synonym:CMD1II; CRYA2; CTPP2; CTRCT16; HEL-S-101; HSPB5; MFM2
Exon (2)110..508
Gene:CRYAB
Gene Synonym:CMD1II; CRYA2; CTPP2; CTRCT16; HEL-S-101; HSPB5; MFM2
Exon (3)509..631
Gene:CRYAB
Gene Synonym:CMD1II; CRYA2; CTPP2; CTRCT16; HEL-S-101; HSPB5; MFM2
Exon (4)632..979
Gene:CRYAB
Gene Synonym:CMD1II; CRYA2; CTPP2; CTRCT16; HEL-S-101; HSPB5; MFM2
Translation MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(27)-dbSNP:
complement(27)-c, adbSNP:57653928
117+dbSNP:
117+a, tdbSNP:28362563
complement(217)-t, cdbSNP:372588653
complement(287)-g, adbSNP:376222434
complement(299)-g, adbSNP:373114236
310+a, gdbSNP:397516686
complement(314)-t, cdbSNP:370579035
complement(334)-t, cdbSNP:142776559
complement(341)-g, adbSNP:375933774
complement(359)-g, adbSNP:373032047
364+a, cdbSNP:11549439
365+c, tdbSNP:387907337
367+, cdbSNP:281865141
complement(367)-g, adbSNP:4252582
complement(382)-g, cdbSNP:199510583
complement(392)-g, cdbSNP:148500053
395+g, tdbSNP:11549440
complement(422)-g, cdbSNP:145768025
complement(423)-g, adbSNP:149787233
complement(427)-t, cdbSNP:374981255
429+a, cdbSNP:2234703
459+c, tdbSNP:2234704
472+a, c, gdbSNP:2228387
473+c, tdbSNP:387907338
complement(494)-t, cdbSNP:375886627
complement(505)-t, cdbSNP:143101974
complement(512)-dbSNP:
complement(512)-g, adbSNP:139750142
520+c, tdbSNP:17850134
complement(576)-t, gdbSNP:201474470
complement(577..578)-, tdbSNP:34725211
complement(627)-t, cdbSNP:144451841
632+dbSNP:
632+c, gdbSNP:387907339
650+, tdbSNP:281865142
665+a, gdbSNP:104894201
complement(680)-g, adbSNP:374661019
complement(713)-t, adbSNP:371079119
725+a, gdbSNP:387907336
758+c, tdbSNP:104894202
complement(767)-t, cdbSNP:150516929
complement(776)-g, adbSNP:374169381
complement(777)-t, cdbSNP:141638421
complement(778)-g, cdbSNP:373551429
complement(792)-g, adbSNP:199861008
complement(794)-g, adbSNP:186242388
complement(817)-g, adbSNP:147970333
complement(818)-t, cdbSNP:370803064
821+c, gdbSNP:11549441
complement(823)-t, gdbSNP:143500486
833+a, tdbSNP:1801966
complement(838)-g, cdbSNP:375893025
complement(839)-g, adbSNP:374078061
complement(851)-g, adbSNP:370347325
complement(971)-t, c, adbSNP:112204677
975+a, gdbSNP:3179808
Gene SymbolCRYAB
Gene SynonymCMD1II; CRYA2; CTPP2; CTRCT16; HEL-S-101; HSPB5; MFM2
Chromosome11
Locus Map11q22.3-q23.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001289807 Homo sapiens crystallin, alpha B (CRYAB), transcript variant 2, mRNA. On-demand $159.00 7-9
NM_001885 Homo sapiens crystallin, alpha B (CRYAB), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_001289808 Homo sapiens crystallin, alpha B (CRYAB), transcript variant 3, mRNA. On-demand $159.00 7-9
Title The small heat-shock protein alphaB-crystallin is essential for the nuclear localization of Smad4: impact on pulmonary fibrosis .
Author Bellaye PS, Wettstein G, Burgy O, Besnard V, Joannes A, Colas J, Causse S, Marchal-Somme J, Fabre A, Crestani B, Kolb M, Gauldie J, Camus P, Garrido C and Bonniaud P.
Journal J. Pathol. 232 (4), 458-472 (2014)
Title Alpha-crystallin-mediated protection of lens cells against heat and oxidative stress-induced cell death .
Author Christopher KL, Pedler MG, Shieh B, Ammar DA, Petrash JM and Mueller NH.
Journal Biochim. Biophys. Acta 1843 (2), 309-315 (2014)
Title Bone morphogenetic proteins protect pulmonary microvascular endothelial cells from apoptosis by upregulating alpha-B-crystallin .
Author Ciumas M, Eyries M, Poirier O, Maugenre S, Dierick F, Gambaryan N, Montagne K, Nadaud S and Soubrier F.
Journal Arterioscler. Thromb. Vasc. Biol. 33 (11), 2577-2584 (2013)
Title Pseudophosphorylated alphaB-crystallin is a nuclear chaperone imported into the nucleus with help of the SMN complex .
Author den Engelsman J, van de Schootbrugge C, Yong J, Pruijn GJ and Boelens WC.
Journal PLoS ONE 8 (9), E73489 (2013)
Title Alpha-crystallin as a molecular chaperone .
Author Derham BK and Harding JJ.
Journal Prog Retin Eye Res 18 (4), 463-509 (1999)
Title Myofibrillar Myopathy .
Author Selcen,D. and Engel,A.G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Site-specific glycation of lens crystallins by ascorbic acid .
Author Ortwerth BJ, Slight SH, Prabhakaram M, Sun Y and Smith JB.
Journal Biochim. Biophys. Acta 1117 (2), 207-215 (1992)
Title Accumulation of alpha B-crystallin in brains of patients with Alexander's disease is not due to an abnormality of the 5'-flanking and coding sequence of the genomic DNA .
Author Iwaki A, Iwaki T, Goldman JE, Ogomori K, Tateishi J and Sakaki Y.
Journal Neurosci. Lett. 140 (1), 89-92 (1992)
Title Copurification of small heat shock protein with alpha B crystallin from human skeletal muscle .
Author Kato K, Shinohara H, Goto S, Inaguma Y, Morishita R and Asano T.
Journal J. Biol. Chem. 267 (11), 7718-7725 (1992)
Title The primary structure of the B2 chain of human alpha-crystallin .
Author Kramps,J.A., de Man,B.M. and de Jong,W.W.
Journal FEBS Lett. 74 (1), 82-84 (1977)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.