• THAT   AND
  • THAT   AND


Homo sapiens casein beta (CSN2), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_001891 Homo sapiens casein beta (CSN2), mRNA. Full Lenth $312.62
ORF Sequence $197.49
RefSeq Version NM_001891.2, 168480124
Length 1078 bp
Structure linear
Update Date 12-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens casein beta (CSN2), mRNA.
Product beta-casein precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC096197.3 and X55739.1. On Feb 22, 2008 this sequence version replaced gi:4503086.

RefSeq NP_001882.1
CDS 14..694
Exon (1)1..64
Exon (2)1..64
Exon (3)65..91
Exon (4)92..112
Exon (5)113..157
Exon (6)158..688
Exon (7)689..730
Exon (8)731..1067
Translation MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQ PQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKS PTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIP QQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(189)-g, adbSNP:79386840
complement(341)-t, cdbSNP:74441570
complement(412)-g, adbSNP:77091095
complement(590)-t, cdbSNP:116775276
complement(599)-g, adbSNP:115451626
complement(779)-t, adbSNP:114863550
complement(781)-t, adbSNP:41292317
complement(809)-c, adbSNP:115939862
complement(977)-g, adbSNP:115292830
complement(1016)-g, adbSNP:2637816
complement(1018)-g, adbSNP:55809028
Gene SymbolCSN2
Gene SynonymCASB
Chromosome4
Locus Map4q21.1
All Transcripts NM_001891
Title Derivatives of human beta-casein fragments (54-59) exhibit highly potent immunosuppressant activity .
Author Puri,A., Bhattacharya,M., Tripathi,L.M. and Haq,W.
Journal Int. Immunopharmacol. 9 (9), 1092-1096 (2009)
Title Analysis of the role of COP9 Signalosome (CSN) subunits in K562; the first link between CSN and autophagy .
Author Pearce,C., Hayden,R.E., Bunce,C.M. and Khanim,F.L.
Journal BMC Cell Biol. 10, 31 (2009)
Title Progesterone receptor repression of prolactin/signal transducer and activator of transcription 5-mediated transcription of the beta-casein gene in mammary epithelial cells .
Author Buser,A.C., Gass-Handel,E.K., Wyszomierski,S.L., Doppler,W., Leonhardt,S.A., Schaack,J., Rosen,J.M., Watkin,H., Anderson,S.M. and Edwards,D.P.
Journal Mol. Endocrinol. 21 (1), 106-125 (2007)
Title Reconstituted micelle formation using reduced, carboxymethylated bovine kappa-casein and human beta-casein .
Author Sood,S.M., Lekic,T., Jhawar,H., Farrell,H.M. Jr. and Slattery,C.W.
Journal Protein J. 25 (5), 352-360 (2006)
Title Phosphorylation of the N-terminal domain regulates subcellular localization and DNA binding properties of the peptidyl-prolyl cis/trans isomerase hPar14 .
Author Reimer,T., Weiwad,M., Schierhorn,A., Ruecknagel,P.K., Rahfeld,J.U., Bayer,P. and Fischer,G.
Journal J. Mol. Biol. 330 (5), 955-966 (2003)
Title A mammalian dual specificity protein kinase, Nek1, is related to the NIMA cell cycle regulator and highly expressed in meiotic germ cells .
Author Letwin,K., Mizzen,L., Motro,B., Ben-David,Y., Bernstein,A. and Pawson,T.
Journal EMBO J. 11 (10), 3521-3531 (1992)
Title Regional localization of human beta-casein gene (CSN2) to 4pter-q21 .
Author Menon,R.S., Chang,Y.F., Jeffers,K.F., Jones,C. and Ham,R.G.
Journal Genomics 13 (1), 225-226 (1992)
Title Cloning and sequencing of a cDNA encoding human milk beta-casein .
Author Lonnerdal,B., Bergstrom,S., Andersson,Y., Hjalmarsson,K., Sundqvist,A.K. and Hernell,O.
Journal FEBS Lett. 269 (1), 153-156 (1990)
Title Human beta-casein: partial cDNA sequence and apparent polymorphism .
Author Menon,R.S. and Ham,R.G.
Journal Nucleic Acids Res. 17 (7), 2869 (1989)
Title Human beta-casein. Amino acid sequence and identification of phosphorylation sites .
Author Greenberg,R., Groves,M.L. and Dower,H.J.
Journal J. Biol. Chem. 259 (8), 5132-5138 (1984)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878