• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001904 Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_001904.3, 148228165
Length 3720 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1, mRNA.
Product catenin beta-1
Comment

Summary: The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Three transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Oct 2009].


Transcript Variant: This variant (1) represents the longest transcript. All three variants encode the same protein.

RefSeq NP_001895.1
CDS 269..2614
Misc Feature(1)227..229
Misc Feature(2)269..337
Misc Feature(3)269..337
Misc Feature(4)335..337
Misc Feature(5)353..355
Misc Feature(6)353..355
Misc Feature(7)353..355
Misc Feature(8)365..367
Misc Feature(9)365..367
Misc Feature(10)377..379
Misc Feature(11)377..379
Misc Feature(12)389..391
Misc Feature(13)389..391
Misc Feature(14)401..403
Misc Feature(15)401..403
Misc Feature(16)401..403
Misc Feature(17)401..403
Misc Feature(18)413..415
Misc Feature(19)458..460
Misc Feature(20)524..526
Misc Feature(21)524..526
Misc Feature(22)572..574
Misc Feature(23)572..574
Misc Feature(24)590..934
Misc Feature(25)602..604
Misc Feature(26)602..604
Misc Feature(27)order(608..610,626..628,638..640,764..766,776..778,
Misc Feature(28)692..694
Misc Feature(29)692..694
Misc Feature(30)692..694
Misc Feature(31)719..841
Misc Feature(32)839..841
Misc Feature(33)845..970
Misc Feature(34)953..1312
Misc Feature(35)971..1096
Misc Feature(36)1004..1006
Misc Feature(37)order(1025..1027,1037..1039,1049..1051,1142..1144,
Misc Feature(38)1097..1222
Misc Feature(39)1223..1348
Misc Feature(40)1259..1261
Misc Feature(41)1316..1438
Misc Feature(42)1349..1435
Misc Feature(43)1445..1447
Misc Feature(44)1463..1822
Misc Feature(45)1466..1591
Misc Feature(46)order(1520..1522,1532..1534,1544..1546,1643..1645,
Misc Feature(47)1592..1720
Misc Feature(48)1715..2137
Misc Feature(49)1733..1858
Misc Feature(50)order(1790..1792,1802..1804,1814..1816,1970..1972,
Misc Feature(51)1859..1981
Misc Feature(52)1919..1921
Misc Feature(53)1922..1924
Misc Feature(54)1922..1924
Misc Feature(55)1934..1936
Misc Feature(56)2048..2176
Misc Feature(57)2177..2266
Misc Feature(58)2228..2230
Misc Feature(59)2228..2230
Misc Feature(60)2291..2293
Misc Feature(61)2291..2293
Misc Feature(62)2582..2611
Exon (1)1..220
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (2)221..281
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (3)282..509
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (4)510..763
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (5)764..1002
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (6)1003..1204
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (7)1205..1349
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (8)1350..1453
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (9)1454..1792
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (10)1793..1951
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (11)1952..2071
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (12)2072..2222
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (13)2223..2344
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (14)2345..2405
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Exon (15)2406..3720
Gene:CTNNB1
Gene Synonym:armadillo; CTNNB; MRD19
Translation MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD L
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
103+dbSNP:
103+g, tdbSNP:13067968
126+a, gdbSNP:13067975
151+c, gdbSNP:11564434
213+c, gdbSNP:11564435
224+dbSNP:
224+a, gdbSNP:4135376
260+c, gdbSNP:5743390
305+a, gdbSNP:121913394
329+a, gdbSNP:121913395
332..382+dbSNP:121913416
333+c, g, tdbSNP:77064436
342..365+, ggcagcaacagtcttacctggactdbSNP:121913417
362+a, c, g, tdbSNP:28931588
363+a, c, g, tdbSNP:121913396
366+a, c, g, tdbSNP:121913400
368+a, gdbSNP:121913399
369+a, g, tdbSNP:28931589
377+c, g, tdbSNP:121913228
378+a, c, g, tdbSNP:121913403
389+a, c, g, tdbSNP:121913412
390+c, tdbSNP:121913413
401+c, g, tdbSNP:121913407
402+a, c, g, tdbSNP:121913409
505+a, gdbSNP:113120762
650+dbSNP:
650+c, tdbSNP:202217100
688+c, tdbSNP:3856746
720+a, gdbSNP:200968230
754+c, tdbSNP:5743392
769+a, gdbSNP:142472167
804+a, cdbSNP:77624106
851+a, gdbSNP:147382769
866+c, tdbSNP:139085081
901+c, tdbSNP:148600849
903+a, gdbSNP:200890083
910+c, tdbSNP:3856747
942+c, gdbSNP:144087793
1025..1026+dbSNP:
1025..1026+, tdbSNP:67701980
1108+a, gdbSNP:13086686
1109..1110+, adbSNP:68115726
1128+a, gdbSNP:35288908
1246+dbSNP:
1246+c, tdbSNP:138154972
1291+c, tdbSNP:34343353
1333+a, gdbSNP:200709497
1423+dbSNP:
1423+a, cdbSNP:74692094
1540+dbSNP:
1540+c, tdbSNP:4135379
1660+c, gdbSNP:141678313
1724+c, tdbSNP:113411271
1784+c, tdbSNP:3856748
1921+dbSNP:
1921+a, gdbSNP:138539284
1925+a, gdbSNP:199593411
1932+a, gdbSNP:186068630
2195+dbSNP:
2195+c, tdbSNP:141493100
2250..2251+dbSNP:
2250..2251+, adbSNP:35523547
2251+a, cdbSNP:1800663
2263+a, cdbSNP:77750814
2293+a, gdbSNP:201061014
2330+a, gdbSNP:4135384
2353+dbSNP:
2353+c, tdbSNP:199856558
2397+a, gdbSNP:200308943
2443+dbSNP:
2443+c, tdbSNP:191410018
2467+c, tdbSNP:148654224
2494+c, tdbSNP:201583088
2533+a, tdbSNP:200991012
2583+a, gdbSNP:138501547
2588+c, tdbSNP:4135386
2608+c, tdbSNP:2293303
2646+c, tdbSNP:116875446
2780..2781+, tdbSNP:201058354
2780+, adbSNP:11564479
2781+c, tdbSNP:146896526
2793+c, tdbSNP:181927582
2842+, gdbSNP:150533740
2843+, tdbSNP:4135244
2908..2910+, agcdbSNP:4135243
2911..2912+, gctdbSNP:201309476
2913+, gctdbSNP:79024415
2920+c, tdbSNP:4135388
2940..2941+, adbSNP:34854135
2986+a, gdbSNP:4135389
3018..3019+, acdbSNP:143836144
3169+g, tdbSNP:2953
3190..3191+, adbSNP:150512515
3193..3194+, tdbSNP:34653633
3194..3195+, adbSNP:71094643
3194+a, tdbSNP:4135387
3258+c, tdbSNP:201175238
3259..3260+, tt, ttttdbSNP:71961438
3259+, tttt, ttttttdbSNP:34534133
3358+a, gdbSNP:11708064
3381..3382+, taatdbSNP:16339
3382..3383+, taatdbSNP:72158483
3383..3384+, aattdbSNP:71727399
3385..3386+, taatdbSNP:3834205
3386..3387+, aattdbSNP:71623294
3387+a, cdbSNP:202194019
3398..3401+, taatdbSNP:72273140
3467+a, gdbSNP:145906085
3471+c, tdbSNP:1798792
3511+g, tdbSNP:1722851
3519+g, tdbSNP:148378295
3576+a, gdbSNP:1058355
3654+c, tdbSNP:116035162
3655+c, gdbSNP:141130241
3715+c, tdbSNP:150729932
Gene SymbolCTNNB1
Gene Synonymarmadillo; CTNNB; MRD19
Chromosome3
Locus Map3p21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001098209 Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 2, mRNA. In-stock $809.00 $760.00 15
NM_001098210 Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 3, mRNA. In-stock $809.00 $760.00 15
NM_001904 Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1, mRNA. In-stock $809.00 $760.00 15
Title B cells in chronically hepatitis C virus-infected individuals lack a virus-induced mutation signature in the TP53, CTNNB1, and BCL6 genes .
Author Tucci,F.A., Broering,R., Johansson,P., Schlaak,J.F. and Kuppers,R.
Journal J. Virol. 87 (5), 2956-2962 (2013)
Title Glucose-induced beta-catenin acetylation enhances Wnt signaling in cancer .
Author Chocarro-Calvo,A., Garcia-Martinez,J.M., Ardila-Gonzalez,S., De la Vieja,A. and Garcia-Jimenez,C.
Journal Mol. Cell 49 (3), 474-486 (2013)
Title Combined loss of E-cadherin and aberrant beta-catenin protein expression correlates with a poor prognosis for small intestinal adenocarcinomas .
Author Lee,H.J., Lee,O.J., Jang,K.T., Bae,Y.K., Chung,J.Y., Eom,D.W., Kim,J.M., Yu,E. and Hong,S.M.
Journal Am. J. Clin. Pathol. 139 (2), 167-176 (2013)
Title Dose-dependent roles for canonical Wnt signalling in de novo crypt formation and cell cycle properties of the colonic epithelium .
Author Hirata,A., Utikal,J., Yamashita,S., Aoki,H., Watanabe,A., Yamamoto,T., Okano,H., Bardeesy,N., Kunisada,T., Ushijima,T., Hara,A., Jaenisch,R., Hochedlinger,K. and Yamada,Y.
Journal Development 140 (1), 66-75 (2013)
Title beta-Catenin-driven cancers require a YAP1 transcriptional complex for survival and tumorigenesis .
Author Rosenbluh,J., Nijhawan,D., Cox,A.G., Li,X., Neal,J.T., Schafer,E.J., Zack,T.I., Wang,X., Tsherniak,A., Schinzel,A.C., Shao,D.D., Schumacher,S.E., Weir,B.A., Vazquez,F., Cowley,G.S., Root,D.E., Mesirov,J.P., Beroukhim,R., Kuo,C.J., Goessling,W. and Hahn,W.C.
Journal Cell 151 (7), 1457-1473 (2012)
Title Identification of plakoglobin domains required for association with N-cadherin and alpha-catenin .
Author Sacco,P.A., McGranahan,T.M., Wheelock,M.J. and Johnson,K.R.
Journal J. Biol. Chem. 270 (34), 20201-20206 (1995)
Title Receptor protein tyrosine phosphatase PTPmu associates with cadherins and catenins in vivo .
Author Brady-Kalnay,S.M., Rimm,D.L. and Tonks,N.K.
Journal J. Cell Biol. 130 (4), 977-986 (1995)
Title c-erbB-2 gene product directly associates with beta-catenin and plakoglobin .
Author Kanai,Y., Ochiai,A., Shibata,T., Oyama,T., Ushijima,S., Akimoto,S. and Hirohashi,S.
Journal Biochem. Biophys. Res. Commun. 208 (3), 1067-1072 (1995)
Title Assignment of the human beta-catenin gene (CTNNB1) to 3p22-->p21.3 by fluorescence in situ hybridization .
Author van Hengel,J., Nollet,F., Berx,G., van Roy,N., Speleman,F. and van Roy,F.
Journal Cytogenet. Cell Genet. 70 (1-2), 68-70 (1995)
Title Assembly of the cadherin-catenin complex in vitro with recombinant proteins .
Author Aberle,H., Butz,S., Stappert,J., Weissig,H., Kemler,R. and Hoschuetzky,H.
Journal J. Cell. Sci. 107 (PT 12), 3655-3663 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.