• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glutamyl aminopeptidase (aminopeptidase A) (ENPEP), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu29937 Homo sapiens glutamyl aminopeptidase (aminopeptidase A) (ENPEP), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu29937C Homo sapiens glutamyl aminopeptidase (aminopeptidase A) (ENPEP), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001977.3, 132814466
Length 2874 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens glutamyl aminopeptidase (aminopeptidase A) (ENPEP), mRNA.
Product glutamyl aminopeptidase
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB070526.1, BC094770.1, AC098798.4, BG400415.1, AL568777.3 and AI640493.1. On Mar 15, 2007 this sequence version replaced gi:36951115.

RefSeq NP_001968.3
CDS 343..3216
Misc Feature(1)319..321
Misc Feature(2)397..459
Misc Feature(3)397..459
Misc Feature(4)607..3162
Misc Feature(5)640..1977
Misc Feature(6)1411..1425
Misc Feature(7)order(1519..1521,1531..1533,1588..1590)
Misc Feature(8)1777..1779
Misc Feature(9)2188..3141
Exon (1)1..986
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (2)987..1128
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (3)1129..1260
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (4)1261..1381
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (5)1382..1536
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (6)1537..1650
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (7)1651..1785
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (8)1786..1851
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (9)1852..1917
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (10)1918..2069
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (11)2070..2149
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (12)2150..2286
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (13)2287..2342
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (14)2343..2493
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (15)2494..2567
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (16)2568..2672
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (17)2673..2843
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (18)2844..2984
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (19)2985..3063
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (20)3064..4995
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Translation MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
116+dbSNP:
116+a, cdbSNP:138856188
132+c, tdbSNP:185786013
135+c, gdbSNP:113262412
354+a, gdbSNP:201919062
357+a, gdbSNP:61735573
363+a, gdbSNP:149344736
366+c, tdbSNP:201390327
368+c, gdbSNP:147278588
400+a, gdbSNP:139117778
414+g, tdbSNP:143034817
421+c, gdbSNP:376295434
423+a, gdbSNP:150822200
436+a, gdbSNP:72890294
445+c, tdbSNP:371103875
450+c, tdbSNP:76248418
481+a, gdbSNP:377592598
494+c, tdbSNP:199759636
503+c, tdbSNP:200528408
507+a, gdbSNP:144097614
543+c, tdbSNP:148668096
551+c, tdbSNP:190110065
598+a, gdbSNP:370568319
616+c, gdbSNP:143343563
649+a, gdbSNP:146706022
669+a, gdbSNP:139191077
683+c, gdbSNP:183715198
684+c, tdbSNP:368458365
730+c, tdbSNP:200626632
738+a, gdbSNP:371805680
752+a, gdbSNP:144015322
753+a, gdbSNP:376013748
complement(755)-g, adbSNP:79504180
761+c, gdbSNP:150932741
772+c, gdbSNP:140663821
776+c, tdbSNP:375739854
788+a, gdbSNP:150487146
792+c, tdbSNP:367787109
807+a, gdbSNP:145393212
819+g, tdbSNP:142566268
825+c, tdbSNP:146450390
847+a, gdbSNP:201187378
856+c, gdbSNP:144697393
860+a, cdbSNP:139181881
861+g, tdbSNP:373421438
880+a, cdbSNP:75626276
908+c, tdbSNP:375233805
919+c, gdbSNP:143107150
921+c, tdbSNP:186549879
928+c, tdbSNP:112068198
942+c, gdbSNP:111608947
968+c, tdbSNP:148088746
979+c, tdbSNP:141820677
980+a, gdbSNP:10004516
995+dbSNP:
995+c, tdbSNP:1126483
1002+c, tdbSNP:141791964
1055+a, gdbSNP:146242839
1067+c, tdbSNP:200540684
1074+a, gdbSNP:372916413
1120+c, gdbSNP:377134824
1122+a, cdbSNP:370218862
1127+c, tdbSNP:373049379
1129+dbSNP:
1129+a, gdbSNP:368709828
1152+a, gdbSNP:201626651
1159+c, tdbSNP:139258778
1162+a, gdbSNP:201253108
1166+a, cdbSNP:200421305
1167+c, tdbSNP:202181000
1173+a, gdbSNP:374549611
1193+c, tdbSNP:201316974
1197+c, tdbSNP:140795900
1220+a, gdbSNP:377420203
1230+c, tdbSNP:144929555
1243+c, tdbSNP:370829083
1297..1298+dbSNP:
1297..1298+, cdbSNP:34839122
1300+a, gdbSNP:376732795
1353+c, tdbSNP:370520363
1390+dbSNP:
1390+a, gdbSNP:148617807
1411+a, gdbSNP:142050074
1415+c, gdbSNP:374609714
1418+c, tdbSNP:368712110
1439+c, tdbSNP:151125401
1482+c, tdbSNP:201395725
1483+c, tdbSNP:111983919
1489+a, gdbSNP:201272540
1499+a, gdbSNP:200606594
1536+a, gdbSNP:34631771
1550+dbSNP:
1550+c, tdbSNP:199582017
1580+a, gdbSNP:33966350
1617+g, tdbSNP:376604659
1632+a, gdbSNP:147930792
1651+dbSNP:
1651+a, cdbSNP:151006682
1652+a, gdbSNP:34949711
1675+a, gdbSNP:373034509
1687+c, gdbSNP:377495347
1692+a, gdbSNP:376133149
1702+g, tdbSNP:370220462
1712+c, tdbSNP:199991890
1713+a, gdbSNP:372915832
1751+a, tdbSNP:200498489
1763+c, tdbSNP:138193515
1782+c, tdbSNP:149569358
1830+dbSNP:
1830+a, gdbSNP:267599982
1878+dbSNP:
1878+g, tdbSNP:374491820
1918+dbSNP:
1918+c, gdbSNP:143234247
1927+c, tdbSNP:138785083
1941+a, cdbSNP:371587107
1973+a, tdbSNP:143212590
1986+c, tdbSNP:201367483
1987+a, gdbSNP:146261286
2000+a, cdbSNP:200733220
2050+c, tdbSNP:138043602
2097+dbSNP:
2097+a, gdbSNP:267599983
2148+a, cdbSNP:141720845
2159+dbSNP:
2159+a, tdbSNP:369549030
2160+g, tdbSNP:150543830
2166+a, cdbSNP:373016676
2208+c, tdbSNP:139507887
2210+a, gdbSNP:200838648
2224+c, tdbSNP:149676891
2225+a, gdbSNP:147351196
2274+c, tdbSNP:150450748
2305+dbSNP:
2305+c, tdbSNP:139405480
2306+a, gdbSNP:142728357
2327+a, cdbSNP:200157627
2360+dbSNP:
2360+a, gdbSNP:144934961
2362+a, gdbSNP:375534538
2366+g, tdbSNP:71603079
2367+g, tdbSNP:147947032
2368+a, gdbSNP:141772249
2388+c, tdbSNP:113303570
2398+a, gdbSNP:142911369
2415+a, gdbSNP:376425083
2423+a, gdbSNP:71603080
2433+a, gdbSNP:151071815
2478+a, gdbSNP:140989660
2481+a, tdbSNP:368424447
2511+dbSNP:
2511+a, tdbSNP:150207444
2531+c, tdbSNP:367777066
2556+c, tdbSNP:199906584
2565+a, gdbSNP:371265616
2568+dbSNP:
2568+a, gdbSNP:182927441
2620+c, gdbSNP:138819789
2624+a, tdbSNP:138888423
2640+a, gdbSNP:375230746
2668+c, gdbSNP:140475203
2705+dbSNP:
2705+a, g, tdbSNP:138109608
2742+a, gdbSNP:267599984
2806+a, gdbSNP:373396405
2867+dbSNP:
2867+c, tdbSNP:200338472
2868+a, gdbSNP:113642189
2875+a, gdbSNP:376347849
2905+c, tdbSNP:201624755
2913+c, g, tdbSNP:372953285
2922+c, tdbSNP:149519659
2925+a, cdbSNP:35812243
2952+a, gdbSNP:148232326
2984+a, gdbSNP:141205275
3002+dbSNP:
3002+a, gdbSNP:377658225
3034+a, cdbSNP:191649605
3080+dbSNP:
3080+a, cdbSNP:77270199
3098+a, gdbSNP:371337822
3110+a, tdbSNP:188236443
3115+a, gdbSNP:147367863
3128+c, tdbSNP:113501401
3171+a, cdbSNP:139469362
3189+g, tdbSNP:201213870
3194+c, tdbSNP:144996738
3201+a, gdbSNP:369428066
3219+a, c, tdbSNP:17623663
3227+c, tdbSNP:377447470
3322+a, gdbSNP:180739395
3479+g, tdbSNP:371340068
3505+c, tdbSNP:1448816
3635+a, cdbSNP:1042279
3635+a, cdbSNP:111176144
3676+c, tdbSNP:184867101
3759+g, tdbSNP:189671368
3820+a, gdbSNP:181755928
3839+a, tdbSNP:138265496
3939+a, cdbSNP:186925033
3953+c, tdbSNP:149626302
3955+c, gdbSNP:17041902
3981+a, gdbSNP:144482481
3982+a, tdbSNP:189504501
4071+a, gdbSNP:1056355
4104+g, tdbSNP:375102378
complement(4573)-g, adbSNP:148437568
4599+c, gdbSNP:181808917
4641+a, gdbSNP:142319054
complement(4645)-g, adbSNP:2290105
4829+c, tdbSNP:76545347
4863+a, gdbSNP:185207804
4881..4882+, cdbSNP:34730464
4948+g, tdbSNP:189763491
Gene SymbolENPEP
Gene SynonymAPA; CD249; gp160
Chromosome4
Locus Map4q25
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001977 Homo sapiens glutamyl aminopeptidase (aminopeptidase A) (ENPEP), mRNA. On-demand $279.00 12-14
Title Structural insights into central hypertension regulation by human aminopeptidase A .
Author Yang Y, Liu C, Lin YL and Li F.
Journal J. Biol. Chem. 288 (35), 25638-25645 (2013)
Title Does the aminopeptidase A have prognostic and diagnostic value in Chagas disease and other dilated cardiomyopathies? .
Author Wang Y, Moreira Mda C, Heringer-Walther S, Khan A, Schultheiss HP, Wessel N, Siems WE and Walther T.
Journal J. Cardiovasc. Pharmacol. 58 (4), 374-379 (2011)
Title Human metabolic individuality in biomedical and pharmaceutical research .
Author Suhre K, Shin SY, Petersen AK, Mohney RP, Meredith D, Wagele B, Altmaier E, Deloukas P, Erdmann J, Grundberg E, Hammond CJ, de Angelis MH, Kastenmuller G, Kottgen A, Kronenberg F, Mangino M, Meisinger C, Meitinger T, Mewes HW, Milburn MV, Prehn C, Raffler J, Ried JS, Romisch-Margl W, Samani NJ, Small KS, Wichmann HE, Zhai G, Illig T, Spector TD, Adamski J, Soranzo N and Gieger C.
Journal Nature 477 (7362), 54-60 (2011)
Title Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians .
Author Kato N, Takeuchi F, Tabara Y, Kelly TN, Go MJ, Sim X, Tay WT, Chen CH, Zhang Y, Yamamoto K, Katsuya T, Yokota M, Kim YJ, Ong RT, Nabika T, Gu D, Chang LC, Kokubo Y, Huang W, Ohnaka K, Yamori Y, Nakashima E, Jaquish CE, Lee JY, Seielstad M, Isono M, Hixson JE, Chen YT, Miki T, Zhou X, Sugiyama T, Jeon JP, Liu JJ, Takayanagi R, Kim SS, Aung T, Sung YJ, Zhang X, Wong TY, Han BG, Kobayashi S, Ogihara T, Zhu D, Iwai N, Wu JY, Teo YY, Tai ES, Cho YS and He J.
Journal Nat. Genet. 43 (6), 531-538 (2011)
Title A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts .
Author Kalsi G, Kuo PH, Aliev F, Alexander J, McMichael O, Patterson DG, Walsh D, Zhao Z, Schuckit M, Nurnberger J Jr, Edenberg H, Kramer J, Hesselbrock V, Tischfield JA, Vladimirov V, Prescott CA, Dick DM, Kendler KS and Riley BP.
Journal Hum. Mol. Genet. 19 (12), 2497-2506 (2010)
Title The in vivo metabolism of cholecystokinin (CCK-8) is essentially ensured by aminopeptidase A .
Author Migaud M, Durieux C, Viereck J, Soroca-Lucas E, Fournie-Zaluski MC and Roques BP.
Journal Peptides 17 (4), 601-607 (1996)
Title cDNA cloning and expression of human glutamyl aminopeptidase (aminopeptidase A) .
Author Li L, Wang J and Cooper MD.
Journal Genomics 17 (3), 657-664 (1993)
Title Molecular cloning of the human kidney differentiation antigen gp160: human aminopeptidase A .
Author Nanus DM, Engelstein D, Gastl GA, Gluck L, Vidal MJ, Morrison M, Finstad CL, Bander NH and Albino AP.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (15), 7069-7073 (1993)
Title Receptor-mediated induction of aminopeptidase A (APA) of human glomerular epithelial cells (HGEC) by glucocorticoids .
Author Stefanovic V, Vlahovic P, Ardaillou N and Ardaillou R.
Journal FEBS Lett. 294 (3), 171-174 (1991)
Title Antiproliferative and antitumor effects of alpha-interferon in renal cell carcinomas: correlation with the expression of a kidney-associated differentiation glycoprotein .
Author Nanus DM, Pfeffer LM, Bander NH, Bahri S and Albino AP.
Journal Cancer Res. 50 (14), 4190-4194 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.