• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glutamyl aminopeptidase (aminopeptidase A) (ENPEP), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001977 Homo sapiens glutamyl aminopeptidase (aminopeptidase A) (ENPEP), mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_001977.3, 132814466
Length 5004 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens glutamyl aminopeptidase (aminopeptidase A) (ENPEP), mRNA.
Product glutamyl aminopeptidase
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB070526.1, BC094770.1, AC098798.4, BG400415.1, AL568777.3 and AI640493.1. On Mar 15, 2007 this sequence version replaced gi:36951115.

RefSeq NP_001968.3
CDS 343..3216
Misc Feature(1)319..321
Misc Feature(2)397..459
Misc Feature(3)397..459
Misc Feature(4)616..1788
Misc Feature(5)640..1977
Misc Feature(6)1411..1425
Misc Feature(7)order(1519..1521,1531..1533,1588..1590)
Misc Feature(8)1777..1779
Misc Feature(9)2188..3141
Exon (1)1..986
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (2)987..1128
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (3)1129..1260
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (4)1261..1381
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (5)1382..1536
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (6)1537..1650
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (7)1651..1785
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (8)1786..1851
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (9)1852..1917
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (10)1918..2069
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (11)2070..2149
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (12)2150..2286
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (13)2287..2342
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (14)2343..2493
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (15)2494..2567
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (16)2568..2672
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (17)2673..2843
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (18)2844..2984
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (19)2985..3063
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Exon (20)3064..4995
Gene:ENPEP
Gene Synonym:APA; CD249; gp160
Translation MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
116+dbSNP:
116+a, cdbSNP:138856188
132+c, tdbSNP:185786013
135+c, gdbSNP:113262412
354+a, gdbSNP:201919062
357+a, gdbSNP:61735573
363+a, gdbSNP:149344736
366+c, tdbSNP:201390327
368+c, gdbSNP:147278588
400+a, gdbSNP:139117778
414+g, tdbSNP:143034817
423+a, gdbSNP:150822200
436+a, gdbSNP:72890294
450+c, tdbSNP:76248418
494+c, tdbSNP:199759636
503+c, tdbSNP:200528408
507+a, gdbSNP:144097614
543+c, tdbSNP:148668096
551+c, tdbSNP:190110065
616+c, gdbSNP:143343563
649+a, gdbSNP:146706022
669+a, gdbSNP:139191077
683+c, gdbSNP:183715198
730+c, tdbSNP:200626632
752+a, gdbSNP:144015322
755+a, gdbSNP:79504180
761+a, gdbSNP:150932741
772+c, gdbSNP:140663821
788+a, gdbSNP:150487146
807+a, gdbSNP:145393212
819+g, tdbSNP:142566268
825+c, tdbSNP:146450390
847+a, gdbSNP:201187378
856+c, gdbSNP:144697393
860+a, cdbSNP:139181881
880+a, cdbSNP:75626276
919+c, gdbSNP:143107150
921+c, tdbSNP:186549879
928+c, tdbSNP:112068198
942+c, gdbSNP:111608947
968+c, tdbSNP:148088746
979+c, tdbSNP:141820677
980+a, gdbSNP:10004516
995+dbSNP:
995+c, tdbSNP:1126483
1002+c, tdbSNP:141791964
1055+a, gdbSNP:146242839
1067+c, tdbSNP:200540684
1152+dbSNP:
1152+a, gdbSNP:201626651
1159+c, tdbSNP:139258778
1162+a, gdbSNP:201253108
1166+a, cdbSNP:200421305
1167+c, tdbSNP:202181000
1179+c, tdbSNP:149907418
1193+c, tdbSNP:201316974
1197+c, tdbSNP:140795900
1230+c, tdbSNP:144929555
1297..1298+dbSNP:
1297..1298+, cdbSNP:34839122
1390+dbSNP:
1390+a, gdbSNP:148617807
1411+a, gdbSNP:142050074
1439+c, tdbSNP:151125401
1482+c, tdbSNP:201395725
1483+c, tdbSNP:111983919
1489+a, gdbSNP:201272540
1499+a, gdbSNP:200606594
1536+a, gdbSNP:34631771
1550+dbSNP:
1550+c, tdbSNP:199582017
1580+a, gdbSNP:33966350
1632+a, gdbSNP:147930792
1651+dbSNP:
1651+a, cdbSNP:151006682
1652+a, gdbSNP:34949711
1712+c, tdbSNP:199991890
1751+a, tdbSNP:200498489
1763+c, tdbSNP:138193515
1782+c, tdbSNP:149569358
1918+dbSNP:
1918+c, gdbSNP:143234247
1927+c, tdbSNP:138785083
1973+a, tdbSNP:143212590
1986+c, tdbSNP:201367483
1987+a, gdbSNP:146261286
2000+a, cdbSNP:200733220
2050+c, tdbSNP:138043602
2148+dbSNP:
2148+a, cdbSNP:141720845
2160+dbSNP:
2160+g, tdbSNP:150543830
2208+c, tdbSNP:139507887
2210+a, gdbSNP:200838648
2224+c, tdbSNP:149676891
2225+a, gdbSNP:147351196
2274+c, tdbSNP:150450748
2305+dbSNP:
2305+c, tdbSNP:139405480
2306+a, gdbSNP:142728357
2327+a, cdbSNP:200157627
2360+dbSNP:
2360+a, gdbSNP:144934961
2366+g, tdbSNP:71603079
2367+g, tdbSNP:147947032
2368+a, gdbSNP:141772249
2388+c, tdbSNP:113303570
2398+a, gdbSNP:142911369
2423+a, gdbSNP:71603080
2433+a, gdbSNP:151071815
2478+a, gdbSNP:140989660
2511+dbSNP:
2511+a, tdbSNP:150207444
2556+c, tdbSNP:199906584
2568+dbSNP:
2568+a, gdbSNP:182927441
2620+c, gdbSNP:138819789
2624+a, tdbSNP:138888423
2668+c, gdbSNP:140475203
2705+dbSNP:
2705+a, g, tdbSNP:138109608
2867+dbSNP:
2867+c, tdbSNP:200338472
2868+a, gdbSNP:113642189
2905+c, tdbSNP:201624755
2922+c, tdbSNP:149519659
2925+a, cdbSNP:35812243
2952+a, gdbSNP:148232326
2984+a, gdbSNP:141205275
3034+dbSNP:
3034+a, cdbSNP:191649605
3080+dbSNP:
3080+a, cdbSNP:77270199
3110+a, tdbSNP:188236443
3115+a, gdbSNP:147367863
3128+c, tdbSNP:113501401
3171+a, cdbSNP:139469362
3189+g, tdbSNP:201213870
3194+c, tdbSNP:144996738
3219+a, tdbSNP:17623663
3322+a, gdbSNP:180739395
3505+c, tdbSNP:1448816
3635+a, cdbSNP:1042279
3676+c, tdbSNP:184867101
3759+g, tdbSNP:189671368
3820+a, gdbSNP:181755928
3839+a, tdbSNP:138265496
3939+a, cdbSNP:186925033
3953+c, tdbSNP:149626302
3955+c, gdbSNP:17041902
3981+a, gdbSNP:144482481
3982+a, tdbSNP:189504501
4071+a, gdbSNP:1056355
4573+a, gdbSNP:148437568
4599+c, gdbSNP:181808917
4641+a, gdbSNP:142319054
4645+a, gdbSNP:2290105
4829+c, tdbSNP:76545347
4863+a, gdbSNP:185207804
4881..4882+, cdbSNP:34730464
4948+g, tdbSNP:189763491
Gene SymbolENPEP
Gene SynonymAPA; CD249; gp160
Chromosome4
Locus Map4q25
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001977 Homo sapiens glutamyl aminopeptidase (aminopeptidase A) (ENPEP), mRNA. On-demand $899.00 20
Title Does the aminopeptidase A have prognostic and diagnostic value in Chagas disease and other dilated cardiomyopathies? .
Author Wang,Y., Moreira Mda,C., Heringer-Walther,S., Khan,A., Schultheiss,H.P., Wessel,N., Siems,W.E. and Walther,T.
Journal J. Cardiovasc. Pharmacol. 58 (4), 374-379 (2011)
Title Human metabolic individuality in biomedical and pharmaceutical research .
Author Suhre,K., Shin,S.Y., Petersen,A.K., Mohney,R.P., Meredith,D., Wagele,B., Altmaier,E., Deloukas,P., Erdmann,J., Grundberg,E., Hammond,C.J., de Angelis,M.H., Kastenmuller,G., Kottgen,A., Kronenberg,F., Mangino,M., Meisinger,C., Meitinger,T., Mewes,H.W., Milburn,M.V., Prehn,C., Raffler,J., Ried,J.S., Romisch-Margl,W., Samani,N.J., Small,K.S., Wichmann,H.E., Zhai,G., Illig,T., Spector,T.D., Adamski,J., Soranzo,N. and Gieger,C.
Journal Nature 477 (7362), 54-60 (2011)
Title Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians .
Author Kato,N., Takeuchi,F., Tabara,Y., Kelly,T.N., Go,M.J., Sim,X., Tay,W.T., Chen,C.H., Zhang,Y., Yamamoto,K., Katsuya,T., Yokota,M., Kim,Y.J., Ong,R.T., Nabika,T., Gu,D., Chang,L.C., Kokubo,Y., Huang,W., Ohnaka,K., Yamori,Y., Nakashima,E., Jaquish,C.E., Lee,J.Y., Seielstad,M., Isono,M., Hixson,J.E., Chen,Y.T., Miki,T., Zhou,X., Sugiyama,T., Jeon,J.P., Liu,J.J., Takayanagi,R., Kim,S.S., Aung,T., Sung,Y.J., Zhang,X., Wong,T.Y., Han,B.G., Kobayashi,S., Ogihara,T., Zhu,D., Iwai,N., Wu,J.Y., Teo,Y.Y., Tai,E.S., Cho,Y.S. and He,J.
Journal Nat. Genet. 43 (6), 531-538 (2011)
Title A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts .
Author Kalsi,G., Kuo,P.H., Aliev,F., Alexander,J., McMichael,O., Patterson,D.G., Walsh,D., Zhao,Z., Schuckit,M., Nurnberger,J. Jr., Edenberg,H., Kramer,J., Hesselbrock,V., Tischfield,J.A., Vladimirov,V., Prescott,C.A., Dick,D.M., Kendler,K.S. and Riley,B.P.
Journal Hum. Mol. Genet. 19 (12), 2497-2506 (2010)
Title The effect of recombinant aminopeptidase A (APA) on hypertension in pregnant spontaneously hypertensive rats (SHRs) .
Author Ishii,M., Hattori,A., Numaguchi,Y., Ma,X., Nagasaka,T., Tsujimoto,M., Murohara,T., Kobayashi,H. and Mizutani,S.
Journal Early Hum. Dev. 85 (9), 589-594 (2009)
Title The in vivo metabolism of cholecystokinin (CCK-8) is essentially ensured by aminopeptidase A .
Author Migaud,M., Durieux,C., Viereck,J., Soroca-Lucas,E., Fournie-Zaluski,M.C. and Roques,B.P.
Journal Peptides 17 (4), 601-607 (1996)
Title cDNA cloning and expression of human glutamyl aminopeptidase (aminopeptidase A) .
Author Li,L., Wang,J. and Cooper,M.D.
Journal Genomics 17 (3), 657-664 (1993)
Title Molecular cloning of the human kidney differentiation antigen gp160: human aminopeptidase A .
Author Nanus,D.M., Engelstein,D., Gastl,G.A., Gluck,L., Vidal,M.J., Morrison,M., Finstad,C.L., Bander,N.H. and Albino,A.P.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (15), 7069-7073 (1993)
Title Receptor-mediated induction of aminopeptidase A (APA) of human glomerular epithelial cells (HGEC) by glucocorticoids .
Author Stefanovic,V., Vlahovic,P., Ardaillou,N. and Ardaillou,R.
Journal FEBS Lett. 294 (3), 171-174 (1991)
Title Antiproliferative and antitumor effects of alpha-interferon in renal cell carcinomas: correlation with the expression of a kidney-associated differentiation glycoprotein .
Author Nanus,D.M., Pfeffer,L.M., Bander,N.H., Bahri,S. and Albino,A.P.
Journal Cancer Res. 50 (14), 4190-4194 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.