• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens excision repair cross-complementation group 1 (ERCC1), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu52101 Homo sapiens excision repair cross-complementation group 1 (ERCC1), transcript variant 2, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu52101C Homo sapiens excision repair cross-complementation group 1 (ERCC1), transcript variant 2, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_001983.3, 260593722
Length 894 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens excision repair cross-complementation group 1 (ERCC1), transcript variant 2, mRNA.
Product DNA excision repair protein ERCC-1 isoform 2
Comment

Summary: The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand. [provided by RefSeq, Oct 2009].


Transcript Variant: This variant (2) represents the longest transcript and encodes isoform 2.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_001974.1
CDS 147..1040
Misc Feature(1)123..125
Misc Feature(2)147..149
Misc Feature(3)147..149
Misc Feature(4)195..215
Misc Feature(5)441..776
Misc Feature(6)804..1037
Misc Feature(7)861..1019
Exon (1)1..139
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Exon (2)140..251
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Exon (3)252..467
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Exon (4)468..571
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Exon (5)572..671
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Exon (6)672..748
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Exon (7)749..848
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Exon (8)849..920
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Exon (9)921..989
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Exon (10)990..3382
Gene:ERCC1
Gene Synonym:COFS4; RAD10; UV20
Translation MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTY AEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVP WEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQ ALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLT TVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(19)-dbSNP:
complement(19)-g, cdbSNP:372444203
complement(20)-t, cdbSNP:3212932
complement(42)-t, cdbSNP:3212933
55+c, tdbSNP:41540513
complement(128)-c, adbSNP:41559012
complement(145)-dbSNP:
complement(145)-t, gdbSNP:61758159
complement(163)-t, cdbSNP:145482678
complement(275)-dbSNP:
complement(275)-t, cdbSNP:199769934
complement(301)-g, adbSNP:149666093
complement(314)-g, adbSNP:372298794
complement(326)-g, adbSNP:374750310
complement(329)-g, adbSNP:139648033
complement(330)-t, cdbSNP:150584960
complement(337)-g, adbSNP:142631483
complement(350)-g, adbSNP:374723176
complement(351)-g, adbSNP:139307454
complement(371)-g, adbSNP:3212947
complement(371)-g, adbSNP:386580932
376+a, cdbSNP:3188420
complement(400)-c, adbSNP:370774083
complement(407)-t, cdbSNP:369611897
complement(419)-g, cdbSNP:201143699
complement(429)-t, cdbSNP:377366479
complement(431)-t, cdbSNP:374748617
complement(444)-t, cdbSNP:370355287
complement(479)-dbSNP:
complement(479)-g, adbSNP:200767762
complement(492)-t, cdbSNP:200459924
500+c, tdbSNP:11615
complement(518)-g, adbSNP:181766045
complement(521)-g, adbSNP:112246053
complement(522)-t, cdbSNP:374992813
complement(530)-g, adbSNP:139827427
complement(536)-g, adbSNP:56148539
complement(545)-g, adbSNP:369015099
complement(575)-dbSNP:
complement(575)-t, gdbSNP:138121582
complement(588)-g, cdbSNP:373490129
complement(592)-t, cdbSNP:150489444
complement(613)-t, cdbSNP:201089019
618+c, tdbSNP:121913027
complement(629)-t, cdbSNP:371397437
complement(720)-dbSNP:
complement(720)-t, cdbSNP:372435532
complement(723)-t, cdbSNP:368405178
complement(740)-g, adbSNP:375782694
complement(741)-t, cdbSNP:141811629
complement(782)-dbSNP:
complement(782)-g, adbSNP:200023670
839+c, gdbSNP:121913028
complement(840)-t, cdbSNP:146749606
complement(868)-dbSNP:
complement(868)-g, adbSNP:368291131
complement(869)-g, adbSNP:141279286
complement(870)-t, cdbSNP:376832053
complement(905)-g, adbSNP:151164004
complement(928)-dbSNP:
complement(928)-t, gdbSNP:142079682
complement(938)-t, cdbSNP:3212976
complement(939)-t, cdbSNP:144868115
complement(940)-g, adbSNP:201384063
complement(941)-g, cdbSNP:144154880
complement(942)-g, adbSNP:3212977
complement(945)-g, adbSNP:146256515
complement(1016)-dbSNP:
complement(1016)-g, adbSNP:374407868
complement(1033)-t, adbSNP:199908411
1049+c, gdbSNP:2229918
complement(1077)-g, adbSNP:368093760
complement(1082)-g, adbSNP:377744579
complement(1083)-t, cdbSNP:189503912
1112+c, gdbSNP:743571
complement(1124)-, gdbSNP:55776297
complement(1216)-t, cdbSNP:371905515
complement(1223)-g, adbSNP:118178942
1237+g, tdbSNP:3212986
complement(1237)-c, adbSNP:386580934
complement(1256)-t, cdbSNP:367572828
complement(1267)-g, adbSNP:376126455
complement(1270)-g, adbSNP:372336084
complement(1295)-g, cdbSNP:199556175
complement(1296)-t, cdbSNP:35448603
complement(1371)-g, cdbSNP:201700017
complement(1374)-g, adbSNP:201278532
complement(1376)-g, adbSNP:143359960
complement(1384)-g, cdbSNP:372260050
complement(1389)-t, cdbSNP:368905711
complement(1405)-g, adbSNP:199701462
complement(1432)-t, cdbSNP:374805034
complement(1464..1466)-, gaadbSNP:374686338
complement(1465..1466)-, gaadbSNP:200430601
complement(1465..1466)-, gaadbSNP:386580935
complement(1481..1483)-, aagdbSNP:35729377
complement(1490)-c, adbSNP:35452819
complement(1496)-t, gdbSNP:372751771
complement(1533)-t, g, adbSNP:201676132
complement(1537)-g, adbSNP:200817062
complement(1539)-t, cdbSNP:199559014
complement(1544)-g, adbSNP:375637409
complement(1547)-g, adbSNP:200242647
complement(1548)-g, adbSNP:201295345
complement(1560)-c, adbSNP:139349157
complement(1565)-t, cdbSNP:373496739
complement(1567)-g, adbSNP:2336219
complement(1567)-g, adbSNP:111197084
complement(1630)-g, adbSNP:762562
complement(1632)-t, cdbSNP:112438131
complement(1649)-t, cdbSNP:140755881
complement(1654)-g, adbSNP:150941977
complement(1658)-g, cdbSNP:62109561
complement(1670)-t, cdbSNP:201152485
complement(1688)-g, cdbSNP:143986694
complement(1691)-g, adbSNP:140434179
complement(1696)-g, cdbSNP:371398284
complement(1715)-g, adbSNP:199895540
complement(1716)-t, cdbSNP:146750944
complement(1760)-g, cdbSNP:371868030
complement(1771)-g, cdbSNP:371563856
complement(1792)-g, adbSNP:143443617
complement(1799)-g, adbSNP:200618543
complement(1829)-t, cdbSNP:386580936
1829+c, tdbSNP:3212988
complement(1844)-g, adbSNP:148669652
complement(1859)-g, adbSNP:199589536
complement(1860)-t, cdbSNP:143986145
complement(1888)-g, adbSNP:372074228
complement(1889)-g, adbSNP:139303076
complement(1903)-t, cdbSNP:3212989
complement(1916)-g, adbSNP:370766397
complement(1942)-g, adbSNP:377364364
complement(1949)-t, cdbSNP:373394597
complement(1951)-g, adbSNP:200817376
complement(1961)-t, cdbSNP:142978273
complement(1971)-c, adbSNP:735482
complement(2012)-g, adbSNP:374741789
complement(2038)-g, adbSNP:370350694
complement(2056)-g, adbSNP:377044122
complement(2062)-t, cdbSNP:147330482
complement(2074)-g, adbSNP:113047593
complement(2092)-t, cdbSNP:201059236
complement(2132)-g, adbSNP:77680493
complement(2165)-t, cdbSNP:148142467
complement(2225)-t, gdbSNP:143757857
complement(2238)-t, cdbSNP:368322936
complement(2285)-t, cdbSNP:149071715
complement(2300..2301)-, adbSNP:35218885
complement(2338)-t, cdbSNP:137924394
complement(2373)-t, cdbSNP:145278578
complement(2408)-t, cdbSNP:201322262
complement(2409)-t, gdbSNP:370128975
complement(2435)-g, adbSNP:367886330
complement(2437)-g, adbSNP:375294528
complement(2450)-g, adbSNP:140241488
complement(2471)-g, adbSNP:200375319
complement(2501)-g, cdbSNP:146656316
complement(2512)-t, cdbSNP:143485921
complement(2517)-g, adbSNP:140862830
complement(2537)-g, adbSNP:150994935
complement(2543)-t, c, adbSNP:113025996
complement(2571)-g, adbSNP:368286738
complement(2577)-g, adbSNP:376830194
complement(2642)-c, adbSNP:187794054
complement(2643)-, tdbSNP:373645122
complement(2643)-t, adbSNP:2013521
complement(2644)-c, adbSNP:202063629
complement(2651)-c, adbSNP:77052728
complement(2653)-t, c, adbSNP:8103749
complement(2653)-, adbSNP:11314106
complement(2654..2655)-, adbSNP:35708119
complement(2654)-c, adbSNP:5828233
complement(2654)-c, adbSNP:28574980
complement(2655)-c, adbSNP:200025030
complement(2662)-c, adbSNP:75205129
complement(2664)-c, adbSNP:368358045
complement(2720)-c, adbSNP:183074620
complement(2916)-g, adbSNP:148038609
complement(2928)-t, cdbSNP:193096276
complement(2958)-t, adbSNP:143529478
complement(3070)-t, cdbSNP:117128015
3076+a, cdbSNP:149272244
complement(3121)-t, cdbSNP:138557840
complement(3181)-t, cdbSNP:111448570
complement(3182)-g, adbSNP:188831361
complement(3269..3278)-, tataagaaacdbSNP:376694674
3301+c, tdbSNP:1046282
complement(3342)-t, adbSNP:183371964
complement(3364)-g, adbSNP:73559395
Gene SymbolERCC1
Gene SynonymCOFS4; RAD10; UV20
Chromosome19
Locus Map19q13.32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001983 Homo sapiens excision repair cross-complementation group 1 (ERCC1), transcript variant 2, mRNA. In-stock $99.00 5-7
NM_001166049 Homo sapiens excision repair cross-complementation group 1 (ERCC1), transcript variant 3, mRNA. In-stock $99.00 5-7
NM_202001 Homo sapiens excision repair cross-complementation group 1 (ERCC1), transcript variant 1, mRNA. In-stock $99.00 5-7
XM_005258634 PREDICTED: Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant X1, mRNA. On-demand $159.00 7-9
XM_005258635 PREDICTED: Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant X2, mRNA. On-demand $159.00 7-9
XM_005258636 PREDICTED: Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant X3, mRNA. On-demand $159.00 7-9
XM_005258637 PREDICTED: Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant X4, mRNA. On-demand $159.00 7-9
Title ERCC1 expression as a predictive marker of cervical cancer treated with cisplatin-based chemoradiation .
Author Muallem MZ, Marnitz S, Richter R, Kohler C, Sehouli J and Arsenic R.
Journal Anticancer Res. 34 (1), 401-406 (2014)
Title ERCC1 expression as a predictor of resistance to platinum-based chemotherapy in primary ovarian cancer .
Author Muallem MZ, Braicu I, Nassir M, Richter R, Sehouli J and Arsenic R.
Journal Anticancer Res. 34 (1), 393-399 (2014)
Title ERCC1 expression and chemosensitivity in uterine cervical adenocarcinoma cells .
Author Torii Y, Kato R, Minami Y, Hasegawa K, Fujii T and Udagawa Y.
Journal Anticancer Res. 34 (1), 107-115 (2014)
Title Excision Repair Cross-Complementation group 1 (ERCC1) C118T SNP does not affect cellular response to oxaliplatin .
Author van Huis-Tanja LH, Kweekel DM, Lu X, Franken K, Koopman M, Gelderblom H, Antonini NF, Punt CJ, Guchelaar HJ and van der Straaten T.
Journal Mutat. Res. 759, 37-44 (2014)
Title Xeroderma Pigmentosum .
Author Kraemer,K.H. and DiGiovanna,J.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Conserved pattern of antisense overlapping transcription in the homologous human ERCC-1 and yeast RAD10 DNA repair gene regions .
Author van Duin M, van Den Tol J, Hoeijmakers JH, Bootsma D, Rupp IP, Reynolds P, Prakash L and Prakash S.
Journal Mol. Cell. Biol. 9 (4), 1794-1798 (1989)
Title Characterization of genes and proteins involved in excision repair of human cells .
Author Hoeijmakers JH.
Journal J. Cell Sci. Suppl. 6, 111-125 (1987)
Title Molecular characterization of the human excision repair gene ERCC-1: cDNA cloning and amino acid homology with the yeast DNA repair gene RAD10 .
Author van Duin,M., de Wit,J., Odijk,H., Westerveld,A., Yasui,A., Koken,M.H., Hoeijmakers,J.H. and Bootsma,D.
Journal Cell 44 (6), 913-923 (1986)
Title Identification of DNA repair genes in the human genome .
Author Hoeijmakers,J.H., van Duin,M., Westerveld,A., Yasui,A. and Bootsma,D.
Journal Cold Spring Harb. Symp. Quant. Biol. 51 (PT 1), 91-101 (1986)
Title Molecular cloning of a human DNA repair gene .
Author Westerveld,A., Hoeijmakers,J.H., van Duin,M., de Wit,J., Odijk,H., Pastink,A., Wood,R.D. and Bootsma,D.
Journal Nature 310 (5976), 425-429 (1984)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.