• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ets variant 6 (ETV6), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_001987 Homo sapiens ets variant 6 (ETV6), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_001987.4, 153267458
Length 5989 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ets variant 6 (ETV6), mRNA.
Product transcription factor ETV6
Comment

Summary: This gene encodes an ETS family transcription factor. The product of this gene contains two functional domains: a N-terminal pointed (PNT) domain that is involved in protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma. [provided by RefSeq, Sep 2008].

RefSeq NP_001978.1
CDS 275..1633
Misc Feature(1)269..271
Misc Feature(2)278..280
Misc Feature(3)278..280
Misc Feature(4)305..310
Misc Feature(5)305..307
Misc Feature(6)320..322
Misc Feature(7)323..325
Misc Feature(8)326..328
Misc Feature(9)326..328
Misc Feature(10)338..340
Misc Feature(11)434..439
Misc Feature(12)437..442
Misc Feature(13)440..643
Misc Feature(14)order(461..463,527..529,536..544,548..553,560..562,
Misc Feature(15)order(497..514,593..601,605..610,617..622)
Misc Feature(16)911..913
Misc Feature(17)1043..1045
Misc Feature(18)1178..1180
Misc Feature(19)1280..1285
Misc Feature(20)1286..1540
Exon (1)1..307
Gene:ETV6
Gene Synonym:TEL; TEL/ABL
Exon (2)308..437
Gene:ETV6
Gene Synonym:TEL; TEL/ABL
Exon (3)438..602
Gene:ETV6
Gene Synonym:TEL; TEL/ABL
Exon (4)603..737
Gene:ETV6
Gene Synonym:TEL; TEL/ABL
Exon (5)738..1283
Gene:ETV6
Gene Synonym:TEL; TEL/ABL
Exon (6)1284..1426
Gene:ETV6
Gene Synonym:TEL; TEL/ABL
Exon (7)1427..1527
Gene:ETV6
Gene Synonym:TEL; TEL/ABL
Exon (8)1528..5989
Gene:ETV6
Gene Synonym:TEL; TEL/ABL
Translation MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIY WSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHI LKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPM ENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILNPRHSVDFKQSRLSEDGLHRE GKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRW EDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
201+dbSNP:
201+a, gdbSNP:182620920
255+c, gdbSNP:200485978
325+dbSNP:
325+c, tdbSNP:144055004
331+c, tdbSNP:147305258
336+a, gdbSNP:139212214
346+a, gdbSNP:143194205
351+c, gdbSNP:150858928
356+a, gdbSNP:34966596
366+c, tdbSNP:149994836
367+g, tdbSNP:201801905
370+a, cdbSNP:201002416
390+a, gdbSNP:144209028
398+a, gdbSNP:199863871
470+dbSNP:
470+a, gdbSNP:139975161
475+c, gdbSNP:143451658
478+c, gdbSNP:202004830
488+g, tdbSNP:72550776
500+g, tdbSNP:121434637
518+a, gdbSNP:202244621
532+a, gdbSNP:11611479
613+dbSNP:
613+a, cdbSNP:72550784
654+a, gdbSNP:140357643
678+a, gdbSNP:201130440
695+c, tdbSNP:146150601
709+, gdbSNP:66956250
770+dbSNP:
770+a, gdbSNP:142603082
796+a, cdbSNP:150969786
809+c, tdbSNP:140772322
815+c, tdbSNP:149660037
816+a, gdbSNP:150089916
846+g, tdbSNP:201820837
847+g, tdbSNP:35030220
855+c, tdbSNP:192765271
861+c, tdbSNP:138600719
862+c, tdbSNP:142652732
876+c, tdbSNP:145477191
879+a, gdbSNP:200351280
903+a, gdbSNP:201298740
906+a, gdbSNP:111871763
916+a, gdbSNP:72550786
973+c, tdbSNP:149416707
997+a, gdbSNP:199557618
1014+c, tdbSNP:144782370
1027+c, tdbSNP:138208833
1032+c, tdbSNP:200525003
1039+a, tdbSNP:148116823
1048+c, tdbSNP:2071149
1049+c, tdbSNP:141868934
1065+a, gdbSNP:150621299
1146+a, gdbSNP:72550787
1159+c, tdbSNP:140005721
1259+a, gdbSNP:184240587
1326+dbSNP:
1326+g, tdbSNP:199735381
1349+a, cdbSNP:141938078
1371+a, gdbSNP:202119450
1407+a, gdbSNP:146280653
1561+dbSNP:
1561+c, tdbSNP:201517292
1594+a, g, tdbSNP:12231057
1650+c, gdbSNP:183579990
1656+c, tdbSNP:72550782
1695+c, tdbSNP:72550783
1706+a, tdbSNP:116163696
1781+a, gdbSNP:188643374
1848+a, c, g, tdbSNP:1058028
1926+c, tdbSNP:114439497
1927+a, gdbSNP:114995773
1992+c, tdbSNP:73281367
2044..2045+, tadbSNP:71435871
2047..2048+, at, tadbSNP:34166149
2048..2049+, atdbSNP:148938293
2057..2058+, atdbSNP:201413317
2057..2058+, at, tatdbSNP:67600135
2058+a, tdbSNP:79663578
2128..2129+a, cdbSNP:1801071
2134+c, tdbSNP:140010615
2147+c, tdbSNP:113420500
2317+a, gdbSNP:72552352
2414+c, gdbSNP:72552353
2415+a, gdbSNP:72552354
2537+c, tdbSNP:12822376
2581+a, cdbSNP:72552355
2610..2614+, agcgcdbSNP:72552341
2616..2619+, gcgcdbSNP:199697595
2617+c, tdbSNP:201545799
2656+a, gdbSNP:72552356
2748+c, tdbSNP:71457109
2760+a, gdbSNP:191387762
2797..2798+, tdbSNP:35812814
2798..2799+, tdbSNP:59396788
2838+a, gdbSNP:2710278
2907+c, gdbSNP:139887205
2917+g, tdbSNP:1062298
3092+a, tdbSNP:78623999
3209+a, cdbSNP:112659697
3243+c, tdbSNP:147273403
3269+a, gdbSNP:183305984
3302+a, gdbSNP:148444634
3320+c, tdbSNP:115533446
3367+c, tdbSNP:186881078
3400+g, tdbSNP:72550770
3516+c, tdbSNP:72550771
3526+c, gdbSNP:142637277
3586+g, tdbSNP:72550772
3603+c, tdbSNP:11552161
3610+c, tdbSNP:72550773
3629+a, gdbSNP:151008926
3692+c, tdbSNP:72550774
3728+c, tdbSNP:72550775
3785+g, tdbSNP:143501237
3917+c, tdbSNP:183543088
3942..3943+, aaagdbSNP:10649660
3943..3944+, aaagdbSNP:67900047
3945..3946+, agaa, gaaadbSNP:3050331
3948..3949+, agaadbSNP:199690814
3950+a, cdbSNP:187884342
3976+c, tdbSNP:146656971
3994+a, gdbSNP:2855748
4031+a, gdbSNP:9870
4082+a, gdbSNP:2855749
4134+c, tdbSNP:1044919
4311+c, tdbSNP:2855750
4379..4380+, ttdbSNP:201886381
4380..4381+, adbSNP:59376864
4381..4406+, ttatatatatatatatatatatatatdbSNP:58803473
4381..4382+, adbSNP:58787654
4381+a, tdbSNP:2710277
4382..4395+, tatatatatatatadbSNP:145144440
4382..4391+, tatatatatadbSNP:71741103
4382..4385+, tatadbSNP:71794866
4382..4383+, tadbSNP:57308697
4403..4438+, atatatatatatatatatatatatatacacacacacdbSNP:71999368
4426+c, tdbSNP:59711518
4429..4434+, acacacdbSNP:144712994
4430+c, tdbSNP:59065647
4434..4443+, cacacacacadbSNP:61009195
4436+a, gdbSNP:2710276
4438+c, tdbSNP:59866364
4444+a, gdbSNP:112762440
4466+c, tdbSNP:2710275
4558+c, tdbSNP:185362936
4610+c, tdbSNP:76396773
4732+c, tdbSNP:140236469
4782+a, gdbSNP:117329147
4864+a, gdbSNP:75672295
4930+a, gdbSNP:2156932
4948+c, tdbSNP:145309593
5002..5003+, adbSNP:3839962
5004..5005+, tdbSNP:3832798
5035+c, gdbSNP:144970932
5069+a, gdbSNP:1051779
5078+a, tdbSNP:11556573
5082+c, tdbSNP:1573612
5127+c, tdbSNP:61921366
5132+a, cdbSNP:79946282
5155+a, tdbSNP:190263521
5271+c, tdbSNP:1573613
5332+a, cdbSNP:72550766
5412+g, tdbSNP:72550767
5426+c, gdbSNP:1051782
5462+a, gdbSNP:149191366
5515+c, gdbSNP:72550768
5532+c, tdbSNP:72550769
5592+g, tdbSNP:181509838
5747+c, gdbSNP:143357697
5769+c, tdbSNP:148372258
5790+c, tdbSNP:143279699
5832..5833+, tdbSNP:147213844
5870..5871+, aadbSNP:71435872
5876+a, gdbSNP:201259889
5877..5878+, aadbSNP:71057779
5905+c, tdbSNP:184235314
5942+a, tdbSNP:188566560
5977..5978+, adbSNP:11458861
5977+, aadbSNP:75609739
Gene SymbolETV6
Gene SynonymTEL; TEL/ABL
Chromosome12
Locus Map12p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001987 Homo sapiens ets variant 6 (ETV6), mRNA. In-stock $509.00 $460.00 12
Title Variant of ETV6/ABL1 gene is associated with leukemia phenotype .
Author Park,J., Kim,M., Lim,J., Kim,Y., Han,K., Kim,J.S., Lee,S., Kim,H.J. and Min,W.S.
Journal Acta Haematol. 129 (2), 78-82 (2013)
Title Rearrangement of the ETS genes ETV-1, ETV-4, ETV-5, and ELK-4 is a clonal event during prostate cancer progression .
Author Shaikhibrahim,Z., Braun,M., Nikolov,P., Boehm,D., Scheble,V., Menon,R., Fend,F., Kristiansen,G., Perner,S. and Wernert,N.
Journal Hum. Pathol. 43 (11), 1910-1916 (2012)
Title CML cells expressing the TEL/MDS1/EVI1 fusion are resistant to imatinib-induced apoptosis through inhibition of BAD, but are resensitized with ABT-737 .
Author Shimada,K., Tomita,A., Minami,Y., Abe,A., Hind,C.K., Kiyoi,H., Cragg,M.S. and Naoe,T.
Journal Exp. Hematol. 40 (9), 724-737 (2012)
Title ETV6 fusion genes in hematological malignancies: a review .
Author De Braekeleer,E., Douet-Guilbert,N., Morel,F., Le Bris,M.J., Basinko,A. and De Braekeleer,M.
Journal Leuk. Res. 36 (8), 945-961 (2012)
Title The SAM domain of human TEL2 can abrogate transcriptional output from TEL1 (ETV-6) and ETS1/ETS2 .
Author Vivekanand,P. and Rebay,I.
Journal PLoS ONE 7 (5), E37151 (2012)
Title The t(12;21) of acute lymphoblastic leukemia results in a tel-AML1 gene fusion .
Author Romana,S.P., Mauchauffe,M., Le Coniat,M., Chumakov,I., Le Paslier,D., Berger,R. and Bernard,O.A.
Journal Blood 85 (12), 3662-3670 (1995)
Title Fusion of the TEL gene on 12p13 to the AML1 gene on 21q22 in acute lymphoblastic leukemia .
Author Golub,T.R., Barker,G.F., Bohlander,S.K., Hiebert,S.W., Ward,D.C., Bray-Ward,P., Morgan,E., Raimondi,S.C., Rowley,J.D. and Gilliland,D.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (11), 4917-4921 (1995)
Title Translocation (12;22) (p13;q11) in myeloproliferative disorders results in fusion of the ETS-like TEL gene on 12p13 to the MN1 gene on 22q11 .
Author Buijs,A., Sherr,S., van Baal,S., van Bezouw,S., van der Plas,D., Geurts van Kessel,A., Riegman,P., Lekanne Deprez,R., Zwarthoff,E., Hagemeijer,A. et al.
Journal Oncogene 10 (8), 1511-1519 (1995)
Title The novel activation of ABL by fusion to an ets-related gene, TEL .
Author Papadopoulos,P., Ridge,S.A., Boucher,C.A., Stocking,C. and Wiedemann,L.M.
Journal Cancer Res. 55 (1), 34-38 (1995)
Title Nucleotide sequence analysis of human abl and bcr-abl cDNAs .
Author Fainstein,E., Einat,M., Gokkel,E., Marcelle,C., Croce,C.M., Gale,R.P. and Canaani,E.
Journal Oncogene 4 (12), 1477-1481 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.