• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens even-skipped homeobox 1 (EVX1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu11389 Homo sapiens even-skipped homeobox 1 (EVX1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu11389C Homo sapiens even-skipped homeobox 1 (EVX1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_001989.3, 84043964
Length 1224 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens even-skipped homeobox 1 (EVX1), mRNA.
Product homeobox even-skipped homolog protein 1
Comment

Summary: This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: X60655.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025095 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_001980.1
CDS 487..1710
Misc Feature(1)199..201
Misc Feature(2)1036..1212
Misc Feature(3)1036..1212
Misc Feature(4)order(1036..1050,1054..1056,1105..1107,1123..1125,
Misc Feature(5)order(1042..1044,1051..1053,1171..1173,1180..1185,
Exon (1)1..913
Gene:EVX1
Gene Synonym:EVX1
Exon (2)914..1170
Gene:EVX1
Gene Synonym:EVX1
Exon (3)1171..1858
Gene:EVX1
Gene Synonym:EVX1
Translation MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRER GGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFY EEIEVSCTPDCATGNAEYQHSKGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSAS DQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKR QRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPF SGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGL APRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(68)-g, adbSNP:147290861
239+a, gdbSNP:115109116
307..308+, cdbSNP:144213307
307+c, tdbSNP:200741251
320+a, gdbSNP:2074399
341+a, gdbSNP:76744817
435+a, gdbSNP:190949069
451+c, tdbSNP:369569472
470..471+, cdbSNP:375314524
486+c, gdbSNP:201433934
493+a, tdbSNP:370673403
497..498+, adbSNP:35132161
534+a, tdbSNP:61733923
535+g, tdbSNP:147870256
541+c, gdbSNP:148966856
587+c, tdbSNP:143688971
694+a, gdbSNP:148774441
703+c, tdbSNP:183219836
817+a, gdbSNP:368309805
919+dbSNP:
919+g, tdbSNP:148247981
927+a, gdbSNP:267601474
928+a, gdbSNP:267601475
948+a, cdbSNP:141244113
953+a, gdbSNP:145580913
954+c, gdbSNP:138158968
969+c, gdbSNP:200963932
1025+c, gdbSNP:200532550
1075+c, gdbSNP:375461284
1097+a, gdbSNP:368325052
1173+dbSNP:
1173+a, gdbSNP:374970574
1204+a, cdbSNP:371479285
1212+c, tdbSNP:202164329
1220+c, tdbSNP:367829335
1230+g, tdbSNP:371979386
1242+a, cdbSNP:142645206
1286+c, gdbSNP:145954143
1287+c, tdbSNP:376919347
1324+c, tdbSNP:200271452
1326..1327+, ctgcccdbSNP:143308454
1356+a, cdbSNP:114407231
1363+g, tdbSNP:200743818
1395+g, tdbSNP:201423153
1507+a, gdbSNP:377423519
1582+a, gdbSNP:201874473
1619+c, tdbSNP:201025206
1716+c, tdbSNP:200161279
1730+c, tdbSNP:192704506
1732+g, tdbSNP:369099868
1742+g, tdbSNP:373777452
1835+a, gdbSNP:149088988
1839..1840+, adbSNP:200729683
Gene SymbolEVX1
Gene SynonymEVX1
Chromosome7
Locus Map7p15.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001989 Homo sapiens even-skipped homeobox 1 (EVX1), mRNA. On-demand TBD TBD
NM_001989 Homo sapiens even-skipped homeobox 1 (EVX1), mRNA. On-demand TBD TBD
NM_001989 Homo sapiens even-skipped homeobox 1 (EVX1), mRNA. On-demand TBD TBD
Title Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations .
Author Franceschini N, Fox E, Zhang Z, Edwards TL, Nalls MA, Sung YJ, Tayo BO, Sun YV, Gottesman O, Adeyemo A, Johnson AD, Young JH, Rice K, Duan Q, Chen F, Li Y, Tang H, Fornage M, Keene KL, Andrews JS, Smith JA, Faul JD, Guangfa Z, Guo W, Liu Y, Murray SS, Musani SK, Srinivasan S, Velez Edwards DR, Wang H, Becker LC, Bovet P, Bochud M, Broeckel U, Burnier M, Carty C, Chasman DI, Ehret G, Chen WM, Chen G, Chen W, Ding J, Dreisbach AW, Evans MK, Guo X, Garcia ME, Jensen R, Keller MF, Lettre G, Lotay V, Martin LW, Moore JH, Morrison AC, Mosley TH, Ogunniyi A, Palmas W, Papanicolaou G, Penman A, Polak JF, Ridker PM, Salako B, Singleton AB, Shriner D, Taylor KD, Vasan R, Wiggins K, Williams SM, Yanek LR, Zhao W, Zonderman AB, Becker DM, Berenson G, Boerwinkle E, Bottinger E, Cushman M, Eaton C, Nyberg F, Heiss G, Hirschhron JN, Howard VJ, Karczewsk KJ, Lanktree MB, Liu K, Liu Y, Loos R, Margolis K, Snyder M, Psaty BM, Schork NJ, Weir DR, Rotimi CN, Sale MM, Harris T, Kardia SL, Hunt SC, Arnett D, Redline S, Cooper RS, Risch NJ, Rao DC, Rotter JI, Chakravarti A, Reiner AP, Levy D, Keating BJ and Zhu X.
Journal Am. J. Hum. Genet. 93 (3), 545-554 (2013)
Title EVEN-SKIPPED HOMEOBOX 1 controls human ES cell differentiation by directly repressing GOOSECOID expression .
Author Kalisz M, Winzi M, Bisgaard HC and Serup P.
Journal Dev. Biol. 362 (1), 94-103 (2012)
Title Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium .
Author Smith NL, Felix JF, Morrison AC, Demissie S, Glazer NL, Loehr LR, Cupples LA, Dehghan A, Lumley T, Rosamond WD, Lieb W, Rivadeneira F, Bis JC, Folsom AR, Benjamin E, Aulchenko YS, Haritunians T, Couper D, Murabito J, Wang YA, Stricker BH, Gottdiener JS, Chang PP, Wang TJ, Rice KM, Hofman A, Heckbert SR, Fox ER, O'Donnell CJ, Uitterlinden AG, Rotter JI, Willerson JT, Levy D, van Duijn CM, Psaty BM, Witteman JC, Boerwinkle E and Vasan RS.
Journal Circ Cardiovasc Genet 3 (3), 256-266 (2010)
Title Transcriptional repression by the human homeobox protein EVX1 in transfected mammalian cells .
Author Briata P, Van De Werken R, Airoldi I, Ilengo C, Di Blas E, Boncinelli E and Corte G.
Journal J. Biol. Chem. 270 (46), 27695-27701 (1995)
Title Isolation and mapping of EVX1, a human homeobox gene homologous to even-skipped, localized at the 5' end of HOX1 locus on chromosome 7 .
Author Faiella A, D'Esposito M, Rambaldi M, Acampora D, Balsofiore S, Stornaiuolo A, Mallamaci A, Migliaccio E, Gulisano M and Simeone A.
Journal Nucleic Acids Res. 19 (23), 6541-6545 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.